Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 3626..4211 | Replicon | plasmid II |
Accession | NZ_LN997847 | ||
Organism | Acinetobacter baumannii isolate R2091 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | ABR2091_RS18425 | Protein ID | WP_058207830.1 |
Coordinates | 3891..4211 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ABR2091_RS18420 | Protein ID | WP_004896911.1 |
Coordinates | 3626..3898 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ABR2091_RS18395 | 1..933 | + | 933 | WP_002124966.1 | replication initiation protein RepM | - |
ABR2091_RS18400 | 975..1553 | + | 579 | WP_197556496.1 | plasmid replication DNA-binding protein | - |
ABR2091_RS19135 | 1573..1716 | + | 144 | WP_171253639.1 | hypothetical protein | - |
ABR2091_RS18405 | 1912..2253 | + | 342 | WP_058207825.1 | hypothetical protein | - |
ABR2091_RS18410 | 2377..3081 | - | 705 | WP_058207826.1 | hypothetical protein | - |
ABR2091_RS18420 | 3626..3898 | - | 273 | WP_004896911.1 | helix-turn-helix domain-containing protein | Antitoxin |
ABR2091_RS18425 | 3891..4211 | - | 321 | WP_058207830.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ABR2091_RS18430 | 4463..4684 | + | 222 | WP_057695020.1 | hypothetical protein | - |
ABR2091_RS18435 | 5016..5207 | - | 192 | WP_057695016.1 | YqaE/Pmp3 family membrane protein | - |
ABR2091_RS18440 | 5237..5518 | - | 282 | WP_144431835.1 | mobilization protein | - |
ABR2091_RS18445 | 5728..7161 | + | 1434 | WP_058207828.1 | MobA/MobL family protein | - |
ABR2091_RS18450 | 7263..7508 | + | 246 | WP_058207829.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..7742 | 7742 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12250.06 Da Isoelectric Point: 7.9835
>T285802 WP_058207830.1 NZ_LN997847:c4211-3891 [Acinetobacter baumannii]
MLFIETSIFTKQIKELVNDEEYRQLQQDLLVQPDKGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSLKDNLTDKETSILRQLVKEQFHG
MLFIETSIFTKQIKELVNDEEYRQLQQDLLVQPDKGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSLKDNLTDKETSILRQLVKEQFHG
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|