Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 459472..460083 | Replicon | chromosome |
Accession | NZ_LN890656 | ||
Organism | Candidatus Promineofilum breve strain Cfx-K |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | CFX0092_RS19145 | Protein ID | WP_095045268.1 |
Coordinates | 459472..459753 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | CFX0092_RS19150 | Protein ID | WP_197699976.1 |
Coordinates | 459772..460083 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFX0092_RS19125 | 454829..455749 | - | 921 | WP_095045265.1 | GNAT family N-acetyltransferase | - |
CFX0092_RS19130 | 455749..456252 | - | 504 | WP_197699975.1 | MaoC family dehydratase | - |
CFX0092_RS19135 | 456328..457062 | - | 735 | WP_157913340.1 | class I SAM-dependent methyltransferase | - |
CFX0092_RS19140 | 457218..459422 | + | 2205 | WP_095045267.1 | acyl-CoA mutase large subunit family protein | - |
CFX0092_RS19145 | 459472..459753 | + | 282 | WP_095045268.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFX0092_RS19150 | 459772..460083 | + | 312 | WP_197699976.1 | HigA family addiction module antidote protein | Antitoxin |
CFX0092_RS19155 | 460161..462338 | + | 2178 | WP_095045269.1 | methylmalonyl-CoA mutase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11115.66 Da Isoelectric Point: 9.6833
>T285783 WP_095045268.1 NZ_LN890656:459472-459753 [Candidatus Promineofilum breve]
MIRSFASKETEKLFRRQFSRKLPEDIQRKARIKLEILDAAGRLNDLRIPPSNRLEKLSGDREGQYSIRINSQWRICFKWE
DDAAHDVEIVDYH
MIRSFASKETEKLFRRQFSRKLPEDIQRKARIKLEILDAAGRLNDLRIPPSNRLEKLSGDREGQYSIRINSQWRICFKWE
DDAAHDVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|