Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2427297..2427898 | Replicon | chromosome |
Accession | NZ_LN890655 | ||
Organism | Candidatus Promineofilum breve strain Cfx-K |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | CFX0092_RS10515 | Protein ID | WP_095043486.1 |
Coordinates | 2427297..2427581 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | CFX0092_RS10520 | Protein ID | WP_095043487.1 |
Coordinates | 2427593..2427898 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFX0092_RS10490 | 2422316..2422696 | + | 381 | WP_095043481.1 | hypothetical protein | - |
CFX0092_RS10495 | 2422736..2423764 | - | 1029 | WP_095043482.1 | C40 family peptidase | - |
CFX0092_RS10500 | 2423861..2424892 | - | 1032 | WP_095043483.1 | dipeptide epimerase | - |
CFX0092_RS10505 | 2424992..2426131 | - | 1140 | WP_095043484.1 | M20 family metallopeptidase | - |
CFX0092_RS10510 | 2426317..2427225 | + | 909 | WP_095043485.1 | hypothetical protein | - |
CFX0092_RS10515 | 2427297..2427581 | + | 285 | WP_095043486.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFX0092_RS10520 | 2427593..2427898 | + | 306 | WP_095043487.1 | HigA family addiction module antidote protein | Antitoxin |
CFX0092_RS10525 | 2427949..2428302 | - | 354 | WP_095043488.1 | DUF5615 family PIN-like protein | - |
CFX0092_RS10530 | 2428307..2428534 | - | 228 | WP_095043489.1 | DUF433 domain-containing protein | - |
CFX0092_RS10535 | 2428597..2430168 | - | 1572 | WP_162292475.1 | YhfC family intramembrane metalloprotease | - |
CFX0092_RS10540 | 2430165..2431115 | - | 951 | WP_095043491.1 | ABC transporter ATP-binding protein | - |
CFX0092_RS10545 | 2431118..2431315 | - | 198 | WP_095043492.1 | PLD nuclease N-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11086.64 Da Isoelectric Point: 9.6242
>T285781 WP_095043486.1 NZ_LN890655:2427297-2427581 [Candidatus Promineofilum breve]
VIVSFASRETELIFHGRVSRKLPHDIQRTARRKLLYLHDAEDLRDLLAPPGNKLEKLKGDREGQYSIRINDQWRICFRWT
SGRALDVEIVDYHS
VIVSFASRETELIFHGRVSRKLPHDIQRTARRKLLYLHDAEDLRDLLAPPGNKLEKLKGDREGQYSIRINDQWRICFRWT
SGRALDVEIVDYHS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|