Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2316442..2317082 | Replicon | chromosome |
Accession | NZ_LN890655 | ||
Organism | Candidatus Promineofilum breve strain Cfx-K |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | CFX0092_RS09935 | Protein ID | WP_095043375.1 |
Coordinates | 2316442..2316759 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | CFX0092_RS09940 | Protein ID | WP_095044879.1 |
Coordinates | 2316771..2317082 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFX0092_RS09925 | 2312800..2314005 | - | 1206 | WP_095043373.1 | ABC transporter ATP-binding protein | - |
CFX0092_RS09930 | 2314418..2316379 | + | 1962 | WP_095043374.1 | aldehyde ferredoxin oxidoreductase family protein | - |
CFX0092_RS09935 | 2316442..2316759 | + | 318 | WP_095043375.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFX0092_RS09940 | 2316771..2317082 | + | 312 | WP_095044879.1 | helix-turn-helix domain-containing protein | Antitoxin |
CFX0092_RS09945 | 2317125..2317511 | + | 387 | WP_095043376.1 | nucleotidyltransferase domain-containing protein | - |
CFX0092_RS09950 | 2317535..2317678 | + | 144 | WP_157913050.1 | DUF2442 domain-containing protein | - |
CFX0092_RS22180 | 2317679..2317843 | + | 165 | WP_157913051.1 | hypothetical protein | - |
CFX0092_RS09960 | 2318045..2319361 | + | 1317 | WP_162292469.1 | CAP domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12140.24 Da Isoelectric Point: 10.3493
>T285779 WP_095043375.1 NZ_LN890655:2316442-2316759 [Candidatus Promineofilum breve]
MVIVETKVFTRQIEELLTDEAYKDLQTELVKRPEVGVLIPGGGGLRKMRWGYQGQGKRGGVRVIYYWAAKQKRILMLFIY
PKNVRDNLSPAQLRALRSIVEAEYQ
MVIVETKVFTRQIEELLTDEAYKDLQTELVKRPEVGVLIPGGGGLRKMRWGYQGQGKRGGVRVIYYWAAKQKRILMLFIY
PKNVRDNLSPAQLRALRSIVEAEYQ
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|