Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 1896571..1897223 | Replicon | chromosome |
Accession | NZ_LN890335 | ||
Organism | Achromobacter xylosoxidans isolate AX_NCIMB_11015_WG |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | BN2877_RS08610 | Protein ID | WP_155865122.1 |
Coordinates | 1896885..1897223 (-) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | BN2877_RS08605 | Protein ID | WP_020925696.1 |
Coordinates | 1896571..1896888 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN2877_RS08600 | 1896008..1896433 | - | 426 | WP_054504346.1 | hypothetical protein | - |
BN2877_RS08605 | 1896571..1896888 | - | 318 | WP_020925696.1 | transcriptional regulator | Antitoxin |
BN2877_RS08610 | 1896885..1897223 | - | 339 | WP_155865122.1 | toxin | Toxin |
BN2877_RS08615 | 1897453..1897961 | + | 509 | Protein_1691 | hypothetical protein | - |
BN2877_RS08620 | 1898015..1898443 | - | 429 | WP_054446086.1 | CopD family protein | - |
BN2877_RS08625 | 1898447..1898758 | - | 312 | WP_049054755.1 | DUF3817 domain-containing protein | - |
BN2877_RS08630 | 1898897..1899853 | + | 957 | WP_197742945.1 | helix-turn-helix domain-containing protein | - |
BN2877_RS08635 | 1899948..1900280 | - | 333 | WP_155865126.1 | hypothetical protein | - |
BN2877_RS08640 | 1900863..1901054 | + | 192 | WP_155865128.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1885780..1906597 | 20817 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13247.19 Da Isoelectric Point: 10.0510
>T285760 WP_155865122.1 NZ_LN890335:c1897223-1896885 [Achromobacter xylosoxidans]
MKAVFVELPAFARHRGDYLDDDDFRLLQQAMMWRPDAGVVIEGTGGLRKMRFGDPRRGKGKRGGLRVIYYWWDGREQFWL
FSLYDKDEVSDLSGREKRMLKGMLDAEREARR
MKAVFVELPAFARHRGDYLDDDDFRLLQQAMMWRPDAGVVIEGTGGLRKMRFGDPRRGKGKRGGLRVIYYWWDGREQFWL
FSLYDKDEVSDLSGREKRMLKGMLDAEREARR
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|