Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1740113..1740706 | Replicon | chromosome |
| Accession | NZ_LN885086 | ||
| Organism | Candidatus Nitrospira inopinata isolate ENR4 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A0S4KUC7 |
| Locus tag | NITINOP_RS08365 | Protein ID | WP_062484746.1 |
| Coordinates | 1740113..1740403 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0S4KTZ4 |
| Locus tag | NITINOP_RS08370 | Protein ID | WP_062487892.1 |
| Coordinates | 1740440..1740706 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NITINOP_RS08345 | 1735295..1736053 | - | 759 | WP_062484742.1 | hypothetical protein | - |
| NITINOP_RS08350 | 1736250..1738733 | + | 2484 | WP_158023303.1 | ATP-dependent DNA helicase RecG | - |
| NITINOP_RS08355 | 1738795..1739118 | + | 324 | WP_062484744.1 | hypothetical protein | - |
| NITINOP_RS08360 | 1739115..1740104 | + | 990 | WP_062484745.1 | Ppx/GppA family phosphatase | - |
| NITINOP_RS08365 | 1740113..1740403 | + | 291 | WP_062484746.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NITINOP_RS08370 | 1740440..1740706 | + | 267 | WP_062487892.1 | HigA family addiction module antidote protein | Antitoxin |
| NITINOP_RS16140 | 1740728..1740883 | + | 156 | WP_158023494.1 | hypothetical protein | - |
| NITINOP_RS08375 | 1741367..1742857 | - | 1491 | WP_062484747.1 | class I SAM-dependent methyltransferase | - |
| NITINOP_RS08380 | 1742921..1743298 | - | 378 | WP_158023304.1 | hypothetical protein | - |
| NITINOP_RS08390 | 1743598..1744065 | + | 468 | WP_062484750.1 | hypothetical protein | - |
| NITINOP_RS08395 | 1744394..1745410 | + | 1017 | WP_162264704.1 | pentapeptide repeat-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11389.85 Da Isoelectric Point: 6.7274
>T285755 WP_062484746.1 NZ_LN885086:1740113-1740403 [Candidatus Nitrospira inopinata]
VIESFANRLAEDLFDDRQSKAVLKFPSDLIRTARRKLLYLHDASEIGDLREPPGNRLEALKGEWKGFYSIRINDQWRVVF
RWHDGNAYEVQIIDYH
VIESFANRLAEDLFDDRQSKAVLKFPSDLIRTARRKLLYLHDASEIGDLREPPGNRLEALKGEWKGFYSIRINDQWRVVF
RWHDGNAYEVQIIDYH
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S4KUC7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S4KTZ4 |