Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5254315..5254910 | Replicon | chromosome |
Accession | NZ_LN871187 | ||
Organism | Pseudomonas aeruginosa strain PAO1_Orsay |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PAO1OR_RS29675 | Protein ID | WP_003113526.1 |
Coordinates | 5254632..5254910 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PAO1OR_RS24205 | Protein ID | WP_003113527.1 |
Coordinates | 5254315..5254620 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAO1OR_RS29645 | 5249428..5249718 | - | 291 | WP_033992920.1 | DUF5447 family protein | - |
PAO1OR_RS24200 | 5249930..5250202 | - | 273 | WP_003115921.1 | hypothetical protein | - |
PAO1OR_RS29660 | 5250732..5251829 | + | 1098 | WP_169917322.1 | protein phosphatase 2C domain-containing protein | - |
PAO1OR_RS29665 | 5251832..5252881 | + | 1050 | WP_003113529.1 | serine/threonine protein kinase | - |
PAO1OR_RS29670 | 5252878..5253951 | + | 1074 | WP_003113528.1 | serine/threonine protein kinase | - |
PAO1OR_RS24205 | 5254315..5254620 | - | 306 | WP_003113527.1 | HigA family addiction module antidote protein | Antitoxin |
PAO1OR_RS29675 | 5254632..5254910 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PAO1OR_RS24210 | 5255239..5257467 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PAO1OR_RS24215 | 5257537..5258184 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PAO1OR_RS24220 | 5258246..5259484 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T285741 WP_003113526.1 NZ_LN871187:c5254910-5254632 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|