Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5190413..5191008 | Replicon | chromosome |
| Accession | NZ_LN870292 | ||
| Organism | Pseudomonas aeruginosa DK1 substr. NH57388A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | PADK1_RS24560 | Protein ID | WP_003117425.1 |
| Coordinates | 5190730..5191008 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PADK1_RS24555 | Protein ID | WP_003113527.1 |
| Coordinates | 5190413..5190718 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PADK1_RS24520 | 5185553..5186401 | + | 849 | WP_023103532.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| PADK1_RS24530 | 5186568..5187509 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| PADK1_RS24535 | 5187626..5188240 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| PADK1_RS24540 | 5188282..5188866 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| PADK1_RS24545 | 5188907..5190007 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| PADK1_RS24555 | 5190413..5190718 | - | 306 | WP_003113527.1 | HigA family addiction module antidote protein | Antitoxin |
| PADK1_RS24560 | 5190730..5191008 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PADK1_RS24570 | 5191337..5193565 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
| PADK1_RS24575 | 5193635..5194282 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PADK1_RS24580 | 5194344..5195582 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T285734 WP_003117425.1 NZ_LN870292:c5191008-5190730 [Pseudomonas aeruginosa DK1]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|