Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 42016..42618 | Replicon | plasmid 3 |
| Accession | NZ_LN868945 | ||
| Organism | Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3V4SQH3 |
| Locus tag | AT698_RS21685 | Protein ID | WP_001159628.1 |
| Coordinates | 42016..42327 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | AT698_RS21690 | Protein ID | WP_000362050.1 |
| Coordinates | 42328..42618 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AT698_RS21650 | 37129..37728 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| AT698_RS21655 | 37722..38594 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| AT698_RS21660 | 38591..39028 | + | 438 | WP_000560969.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| AT698_RS21665 | 39073..40014 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| AT698_RS21670 | 40029..40475 | - | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| AT698_RS21675 | 40472..40783 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
| AT698_RS21680 | 40869..41798 | - | 930 | WP_001127701.1 | alpha/beta hydrolase | - |
| AT698_RS21685 | 42016..42327 | + | 312 | WP_001159628.1 | hypothetical protein | Toxin |
| AT698_RS21690 | 42328..42618 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| AT698_RS21695 | 42665..43594 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| AT698_RS21700 | 43591..44226 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| AT698_RS21705 | 44223..45125 | - | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..147787 | 147787 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12376.29 Da Isoelectric Point: 9.4460
>T285729 WP_001159628.1 NZ_LN868945:42016-42327 [Salmonella enterica subsp. enterica serovar Senftenberg]
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT285729 WP_000362050.1 NZ_LN868945:42328-42618 [Salmonella enterica subsp. enterica serovar Senftenberg]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|