Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-VapI
Location 1767959..1768529 Replicon plasmid 2
Accession NZ_LN868939
Organism Nocardia farcinica strain NCTC11134

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag AMO33_RS24950 Protein ID WP_060594483.1
Coordinates 1767959..1768240 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag AMO33_RS24955 Protein ID WP_060594484.1
Coordinates 1768227..1768529 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AMO33_RS30680 1763153..1763612 + 460 Protein_1608 SRPBCC domain-containing protein -
AMO33_RS24925 1763612..1763965 + 354 WP_060594478.1 nuclear transport factor 2 family protein -
AMO33_RS24930 1764255..1764941 - 687 WP_060594479.1 hypothetical protein -
AMO33_RS24935 1764934..1765548 - 615 WP_086842325.1 TetR/AcrR family transcriptional regulator -
AMO33_RS24940 1765932..1766690 + 759 WP_139337549.1 hypothetical protein -
AMO33_RS24945 1766680..1767801 + 1122 WP_060594482.1 XRE family transcriptional regulator -
AMO33_RS24950 1767959..1768240 + 282 WP_060594483.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
AMO33_RS24955 1768227..1768529 + 303 WP_060594484.1 HigA family addiction module antidote protein Antitoxin
AMO33_RS24960 1768793..1769575 + 783 WP_060595137.1 DUF4111 domain-containing protein -
AMO33_RS31165 1769606..1769815 + 210 WP_107103140.1 antibiotic biosynthesis monooxygenase -
AMO33_RS24965 1769945..1770529 - 585 WP_060594485.1 hypothetical protein -
AMO33_RS24970 1770526..1771053 - 528 WP_159005545.1 TetR/AcrR family transcriptional regulator; helix-turn-helix transcriptional regulator -
AMO33_RS24975 1771197..1772387 - 1191 Protein_1620 MFS transporter -
AMO33_RS24980 1772469..1772939 + 471 WP_041560401.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - mbtH / phoP / icl / tufA 1..2657929 2657929


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(4-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(24-70)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10984.48 Da        Isoelectric Point: 10.5558

>T285725 WP_060594483.1 NZ_LN868939:1767959-1768240 [Nocardia farcinica]
VIRSFGDKETERLWRRERVRSLDPRIHRVALRKLRQVGSAGSLEDLRIPPGNRLEALKGDRVGQHSIRINDQWRICFRWT
DAGPEEVEIVDYH

Download         Length: 282 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 10874.43 Da        Isoelectric Point: 5.0747

>AT285725 WP_060594484.1 NZ_LN868939:1768227-1768529 [Nocardia farcinica]
MTTTDKIAPIHPGEVLMEDFIEGFGITQNKLAVSIGVPPRRINEIVHGKRGVTADTALRLAKYFGTSAEFWLNLQSHYEL
DRAEDIAGEQIAAIVPLGAA

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References