Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) SprA2-SprA2AS/-
Location 2470095..2470279 Replicon chromosome
Accession NZ_LN854556
Organism Staphylococcus aureus strain B155

Toxin (Protein)


Gene name SprA2 Uniprot ID A0A2K4AFL5
Locus tag SABB155_RS12490 Protein ID WP_000482651.1
Coordinates 2470172..2470279 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name SprA2AS
Locus tag -
Coordinates 2470095..2470155 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SABB155_RS12465 2465639..2466754 - 1116 WP_054189927.1 pyridoxal phosphate-dependent aminotransferase family protein -
SABB155_RS12470 2466732..2467739 - 1008 WP_001046647.1 biotin synthase BioB -
SABB155_RS12475 2467741..2469099 - 1359 WP_054189926.1 adenosylmethionine--8-amino-7-oxononanoate transaminase -
SABB155_RS12480 2469077..2469763 - 687 WP_054189925.1 dethiobiotin synthase -
SABB155_RS12485 2469818..2469985 - 168 Protein_2371 hypothetical protein -
- 2470095..2470155 + 61 - - Antitoxin
SABB155_RS12490 2470172..2470279 - 108 WP_000482651.1 type I toxin-antitoxin system Fst family toxin Toxin
SABB155_RS12495 2470413..2470799 - 387 WP_054189924.1 flippase GtxA -
SABB155_RS12500 2471067..2472209 + 1143 WP_054189923.1 glycerate kinase -
SABB155_RS12505 2472269..2472922 + 654 WP_054189922.1 hypothetical protein -
SABB155_RS12510 2473104..2474315 + 1212 WP_054189921.1 multidrug effflux MFS transporter -
SABB155_RS12515 2474439..2474912 - 474 WP_054189920.1 GyrI-like domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3984.75 Da        Isoelectric Point: 11.0582

>T285705 WP_000482651.1 NZ_LN854556:c2470279-2470172 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRSNKKGDK

Download         Length: 108 bp

Antitoxin


Download         Length: 61 bp

>AT285705 NZ_LN854556:2470095-2470155 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCGTAGTGAGGGGA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K4AFL5

Antitoxin

Download structure file

References