Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1850689..1850869 Replicon chromosome
Accession NZ_LN854556
Organism Staphylococcus aureus strain B155

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag SABB155_RS14670 Protein ID WP_001801861.1
Coordinates 1850689..1850784 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1850812..1850869 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SABB155_RS09030 1846090..1846716 + 627 WP_054190584.1 hypothetical protein -
SABB155_RS09035 1846757..1847098 + 342 WP_054190585.1 DUF3969 family protein -
SABB155_RS09040 1847199..1847771 + 573 WP_054190586.1 hypothetical protein -
SABB155_RS09045 1848148..1848984 + 837 WP_054190587.1 ABC transporter ATP-binding protein -
SABB155_RS09055 1849791..1850237 - 447 WP_054190589.1 DUF1433 domain-containing protein -
SABB155_RS14670 1850689..1850784 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1850812..1850869 - 58 - - Antitoxin
SABB155_RS09060 1850907..1851008 + 102 WP_054190590.1 hypothetical protein -
SABB155_RS14325 1850994..1851261 - 268 Protein_1749 transposase -
SABB155_RS14815 1851293..1851655 + 363 WP_054190591.1 hypothetical protein -
SABB155_RS09070 1851677..1852180 + 504 WP_054190592.1 hypothetical protein -
SABB155_RS09075 1852735..1853178 - 444 WP_054190593.1 DUF1433 domain-containing protein -
SABB155_RS09080 1853178..1853621 - 444 WP_054190594.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T285700 WP_001801861.1 NZ_LN854556:1850689-1850784 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT285700 NZ_LN854556:c1850869-1850812 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References