Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1850689..1850869 | Replicon | chromosome |
| Accession | NZ_LN854556 | ||
| Organism | Staphylococcus aureus strain B155 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SABB155_RS14670 | Protein ID | WP_001801861.1 |
| Coordinates | 1850689..1850784 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1850812..1850869 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SABB155_RS09030 | 1846090..1846716 | + | 627 | WP_054190584.1 | hypothetical protein | - |
| SABB155_RS09035 | 1846757..1847098 | + | 342 | WP_054190585.1 | DUF3969 family protein | - |
| SABB155_RS09040 | 1847199..1847771 | + | 573 | WP_054190586.1 | hypothetical protein | - |
| SABB155_RS09045 | 1848148..1848984 | + | 837 | WP_054190587.1 | ABC transporter ATP-binding protein | - |
| SABB155_RS09055 | 1849791..1850237 | - | 447 | WP_054190589.1 | DUF1433 domain-containing protein | - |
| SABB155_RS14670 | 1850689..1850784 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1850812..1850869 | - | 58 | - | - | Antitoxin |
| SABB155_RS09060 | 1850907..1851008 | + | 102 | WP_054190590.1 | hypothetical protein | - |
| SABB155_RS14325 | 1850994..1851261 | - | 268 | Protein_1749 | transposase | - |
| SABB155_RS14815 | 1851293..1851655 | + | 363 | WP_054190591.1 | hypothetical protein | - |
| SABB155_RS09070 | 1851677..1852180 | + | 504 | WP_054190592.1 | hypothetical protein | - |
| SABB155_RS09075 | 1852735..1853178 | - | 444 | WP_054190593.1 | DUF1433 domain-containing protein | - |
| SABB155_RS09080 | 1853178..1853621 | - | 444 | WP_054190594.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T285700 WP_001801861.1 NZ_LN854556:1850689-1850784 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT285700 NZ_LN854556:c1850869-1850812 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|