Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 652616..652954 | Replicon | chromosome |
Accession | NZ_LN854556 | ||
Organism | Staphylococcus aureus strain B155 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | SABB155_RS14095 | Protein ID | WP_077446684.1 |
Coordinates | 652616..652792 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 652780..652954 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SABB155_RS03115 | 647849..651634 | + | 3786 | WP_000582158.1 | hypothetical protein | - |
SABB155_RS03120 | 651624..651776 | + | 153 | WP_001153681.1 | hypothetical protein | - |
SABB155_RS03125 | 651823..652110 | + | 288 | WP_001040261.1 | hypothetical protein | - |
SABB155_RS03130 | 652168..652464 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
SABB155_RS14095 | 652616..652792 | + | 177 | WP_077446684.1 | putative holin-like toxin | Toxin |
- | 652780..652954 | - | 175 | - | - | Antitoxin |
SABB155_RS03140 | 653004..653258 | + | 255 | WP_000611512.1 | phage holin | - |
SABB155_RS03145 | 653270..654025 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
SABB155_RS03150 | 654216..654707 | + | 492 | WP_000919350.1 | staphylokinase | - |
SABB155_RS14605 | 655357..655692 | + | 336 | Protein_606 | SH3 domain-containing protein | - |
SABB155_RS03160 | 656201..656551 | + | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
SABB155_RS03165 | 656604..656864 | - | 261 | WP_001791826.1 | hypothetical protein | - |
SABB155_RS03175 | 657175..657354 | - | 180 | WP_000669789.1 | hypothetical protein | - |
SABB155_RS03180 | 657782..657874 | + | 93 | WP_001788321.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sak / scn | 608586..659962 | 51376 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6844.44 Da Isoelectric Point: 9.9479
>T285691 WP_077446684.1 NZ_LN854556:652616-652792 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKFIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKFIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT285691 NZ_LN854556:c652954-652780 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|