Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 1863019..1863674 | Replicon | chromosome |
| Accession | NZ_LN849008 | ||
| Organism | Bordetella pertussis strain D420 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | - |
| Locus tag | BPD420_RS08945 | Protein ID | WP_047122780.1 |
| Coordinates | 1863019..1863270 (+) | Length | 84 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | Q7VY40 |
| Locus tag | BPD420_RS08950 | Protein ID | WP_003809516.1 |
| Coordinates | 1863273..1863674 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BPD420_RS08920 | 1858180..1859310 | - | 1131 | WP_010930401.1 | helix-turn-helix transcriptional regulator | - |
| BPD420_RS08925 | 1859545..1860126 | + | 582 | WP_019247931.1 | molybdenum cofactor biosysynthesis protein | - |
| BPD420_RS08930 | 1860263..1861327 | + | 1065 | WP_003809510.1 | fructose-bisphosphate aldolase class II | - |
| BPD420_RS08935 | 1861412..1861858 | - | 447 | WP_003819827.1 | GFA family protein | - |
| BPD420_RS08940 | 1862083..1862964 | + | 882 | WP_003809513.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| BPD420_RS08945 | 1863019..1863270 | + | 252 | WP_047122780.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
| BPD420_RS08950 | 1863273..1863674 | + | 402 | WP_003809516.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| BPD420_RS19885 | 1863694..1863930 | + | 237 | WP_010930404.1 | membrane protein | - |
| BPD420_RS08955 | 1863938..1864417 | + | 480 | WP_010930405.1 | disulfide bond formation protein B | - |
| BPD420_RS08960 | 1864567..1865082 | + | 516 | WP_019247930.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| BPD420_RS08965 | 1865085..1866275 | + | 1191 | WP_010930406.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
| BPD420_RS08970 | 1866295..1867332 | + | 1038 | WP_023853543.1 | threonylcarbamoyl-AMP synthase | - |
| BPD420_RS08975 | 1867469..1868491 | + | 1023 | WP_003809532.1 | amino acid ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 8952.52 Da Isoelectric Point: 9.7242
>T285688 WP_047122780.1 NZ_LN849008:1863019-1863270 [Bordetella pertussis]
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
Download Length: 252 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14528.70 Da Isoelectric Point: 8.5005
>AT285688 WP_003809516.1 NZ_LN849008:1863273-1863674 [Bordetella pertussis]
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|