Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 979535..980355 | Replicon | chromosome |
Accession | NZ_LN847264 | ||
Organism | Pseudomonas sp. CCOS 191 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A0F7Y1C6 |
Locus tag | CCOS191_RS04520 | Protein ID | WP_046854219.1 |
Coordinates | 979535..980032 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | A0A0F7XX37 |
Locus tag | CCOS191_RS04525 | Protein ID | WP_046854220.1 |
Coordinates | 980029..980355 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CCOS191_RS04500 | 974714..976240 | + | 1527 | WP_046854216.1 | efflux transporter outer membrane subunit | - |
CCOS191_RS04505 | 976237..978414 | + | 2178 | WP_046854217.1 | FUSC family protein | - |
CCOS191_RS04510 | 978419..978619 | + | 201 | WP_008097766.1 | DUF1656 domain-containing protein | - |
CCOS191_RS04515 | 978630..979490 | + | 861 | WP_046854218.1 | HlyD family secretion protein | - |
CCOS191_RS04520 | 979535..980032 | - | 498 | WP_046854219.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
CCOS191_RS04525 | 980029..980355 | - | 327 | WP_046854220.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
CCOS191_RS04530 | 980464..980910 | - | 447 | WP_046854221.1 | universal stress protein | - |
CCOS191_RS04535 | 981171..982076 | + | 906 | WP_046854222.1 | LysR family transcriptional regulator | - |
CCOS191_RS04540 | 982355..983896 | + | 1542 | WP_046854223.1 | MFS transporter | - |
CCOS191_RS04545 | 983924..984985 | + | 1062 | WP_046854224.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 19122.90 Da Isoelectric Point: 10.4165
>T285682 WP_046854219.1 NZ_LN847264:c980032-979535 [Pseudomonas sp. CCOS 191]
MTETRRKPLCVHGWSVFAHPLFLDKLEALIDEVEVLQRKDPVGYVKKNAAKRLKAIRRLAFDVIAQAPGNPDHRMGGTLG
AEHKHWFRAKFFQQYRLFFRYHASSKIIVLAWVNDDNSKRAYESSDDAYRVFRRMLGNGHPPDDWDQLLQEAAAATARFN
ATLKR
MTETRRKPLCVHGWSVFAHPLFLDKLEALIDEVEVLQRKDPVGYVKKNAAKRLKAIRRLAFDVIAQAPGNPDHRMGGTLG
AEHKHWFRAKFFQQYRLFFRYHASSKIIVLAWVNDDNSKRAYESSDDAYRVFRRMLGNGHPPDDWDQLLQEAAAATARFN
ATLKR
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F7Y1C6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F7XX37 |