Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 313904..314098 | Replicon | chromosome |
Accession | NC_019770 | ||
Organism | Enterococcus faecalis str. Symbioflor 1 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | EFS1_RS14610 | Protein ID | WP_015543884.1 |
Coordinates | 314003..314098 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 313904..313968 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EFS1_RS01590 | 309516..311264 | + | 1749 | WP_002389631.1 | PTS transporter subunit EIIC | - |
EFS1_RS01595 | 311255..313288 | + | 2034 | WP_002361171.1 | transcription antiterminator | - |
EFS1_RS01600 | 313299..313733 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 313904..313968 | + | 65 | - | - | Antitoxin |
EFS1_RS14610 | 314003..314098 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
EFS1_RS01610 | 314345..316117 | + | 1773 | WP_002389635.1 | PTS mannitol transporter subunit IICBA | - |
EFS1_RS01615 | 316132..316569 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
EFS1_RS01620 | 316584..317738 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
EFS1_RS01625 | 317805..318920 | - | 1116 | WP_002389684.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T28568 WP_015543884.1 NC_019770:c314098-314003 [Enterococcus faecalis str. Symbioflor 1]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T28568 NC_019770:c314098-314003 [Enterococcus faecalis str. Symbioflor 1]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT28568 NC_019770:313904-313968 [Enterococcus faecalis str. Symbioflor 1]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|