Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4575973..4576385 | Replicon | chromosome |
Accession | NZ_LN832404 | ||
Organism | Escherichia coli K-12 substr. AG100 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | EK12AG100_RS22660 | Protein ID | WP_000132601.1 |
Coordinates | 4575973..4576314 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4576309..4576385 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EK12AG100_RS22650 | 4573386..4574432 | - | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
EK12AG100_RS22655 | 4574432..4575811 | - | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
EK12AG100_RS22660 | 4575973..4576314 | - | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
- | 4576309..4576385 | + | 77 | NuclAT_13 | - | Antitoxin |
- | 4576309..4576385 | + | 77 | NuclAT_13 | - | Antitoxin |
- | 4576309..4576385 | + | 77 | NuclAT_13 | - | Antitoxin |
- | 4576309..4576385 | + | 77 | NuclAT_13 | - | Antitoxin |
- | 4576309..4576385 | + | 77 | NuclAT_14 | - | Antitoxin |
- | 4576309..4576385 | + | 77 | NuclAT_14 | - | Antitoxin |
- | 4576309..4576385 | + | 77 | NuclAT_14 | - | Antitoxin |
- | 4576309..4576385 | + | 77 | NuclAT_14 | - | Antitoxin |
EK12AG100_RS22665 | 4576542..4577936 | - | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
EK12AG100_RS22670 | 4577933..4579522 | - | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4568888..4577936 | 9048 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T285674 WP_000132601.1 NZ_LN832404:c4576314-4575973 [Escherichia coli K-12]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT285674 NZ_LN832404:4576309-4576385 [Escherichia coli K-12]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|