Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1297123..1297345 | Replicon | chromosome |
| Accession | NZ_LN832404 | ||
| Organism | Escherichia coli K-12 substr. AG100 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | EK12AG100_RS06550 | Protein ID | WP_000170963.1 |
| Coordinates | 1297123..1297230 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1297278..1297345 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EK12AG100_RS06520 | 1292432..1293514 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| EK12AG100_RS06525 | 1293514..1294347 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| EK12AG100_RS06530 | 1294344..1294736 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| EK12AG100_RS06535 | 1294740..1295549 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| EK12AG100_RS06540 | 1295585..1296439 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| EK12AG100_RS06545 | 1296588..1296695 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 1296743..1296809 | + | 67 | NuclAT_33 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_33 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_33 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_33 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_35 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_35 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_35 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_35 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_37 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_37 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_37 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_37 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_39 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_39 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_39 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_39 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_41 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_41 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_41 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_41 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_43 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_43 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_43 | - | - |
| - | 1296743..1296809 | + | 67 | NuclAT_43 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_17 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_17 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_17 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_17 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_20 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_20 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_20 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_20 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_23 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_23 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_23 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_23 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_26 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_26 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_26 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_26 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_29 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_29 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_29 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_29 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_32 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_32 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_32 | - | - |
| - | 1296745..1296810 | + | 66 | NuclAT_32 | - | - |
| EK12AG100_RS06550 | 1297123..1297230 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | Toxin |
| - | 1297278..1297345 | + | 68 | NuclAT_16 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_16 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_16 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_16 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_19 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_19 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_19 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_19 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_22 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_22 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_22 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_22 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_25 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_25 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_25 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_25 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_28 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_28 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_28 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_28 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_31 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_31 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_31 | - | Antitoxin |
| - | 1297278..1297345 | + | 68 | NuclAT_31 | - | Antitoxin |
| - | 1297279..1297344 | + | 66 | NuclAT_34 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_34 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_34 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_34 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_36 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_36 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_36 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_36 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_38 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_38 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_38 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_38 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_40 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_40 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_40 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_40 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_42 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_42 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_42 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_42 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_44 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_44 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_44 | - | - |
| - | 1297279..1297344 | + | 66 | NuclAT_44 | - | - |
| EK12AG100_RS06555 | 1297658..1297765 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 1297813..1297880 | + | 68 | NuclAT_15 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_15 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_15 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_15 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_18 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_18 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_18 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_18 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_21 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_21 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_21 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_21 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_24 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_24 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_24 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_24 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_27 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_27 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_27 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_27 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_30 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_30 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_30 | - | - |
| - | 1297813..1297880 | + | 68 | NuclAT_30 | - | - |
| EK12AG100_RS06560 | 1298169..1299269 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| EK12AG100_RS06565 | 1299539..1299769 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| EK12AG100_RS06570 | 1299927..1300622 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| EK12AG100_RS06575 | 1300666..1301019 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T285652 WP_000170963.1 NZ_LN832404:c1297230-1297123 [Escherichia coli K-12]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 68 bp
>AT285652 NZ_LN832404:1297278-1297345 [Escherichia coli K-12]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|