Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 252173..252867 | Replicon | chromosome |
Accession | NZ_LN832404 | ||
Organism | Escherichia coli K-12 substr. AG100 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | EK12AG100_RS01190 | Protein ID | WP_001263489.1 |
Coordinates | 252469..252867 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | EK12AG100_RS01185 | Protein ID | WP_000554758.1 |
Coordinates | 252173..252466 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EK12AG100_RS01165 | 247805..248302 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
EK12AG100_RS01170 | 248526..250238 | - | 1713 | Protein_225 | flagellar biosynthesis protein FlhA | - |
EK12AG100_RS01175 | 250210..250995 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
EK12AG100_RS01180 | 251066..252121 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
EK12AG100_RS01185 | 252173..252466 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
EK12AG100_RS01190 | 252469..252867 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
EK12AG100_RS01195 | 252877..253329 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
EK12AG100_RS01200 | 253647..253853 | + | 207 | Protein_231 | RtcB family protein | - |
EK12AG100_RS01205 | 253849..254370 | + | 522 | Protein_232 | peptide chain release factor H | - |
EK12AG100_RS01210 | 254427..255884 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
EK12AG100_RS01215 | 256145..256603 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- | 257199..257279 | + | 81 | NuclAT_11 | - | - |
- | 257199..257279 | + | 81 | NuclAT_11 | - | - |
- | 257199..257279 | + | 81 | NuclAT_11 | - | - |
- | 257199..257279 | + | 81 | NuclAT_11 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T285649 WP_001263489.1 NZ_LN832404:252469-252867 [Escherichia coli K-12]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |