Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2484879..2485063 | Replicon | chromosome |
Accession | NZ_LN831036 | ||
Organism | Staphylococcus aureus strain NCTC13435 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | AT694_RS12660 | Protein ID | WP_000482652.1 |
Coordinates | 2484956..2485063 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2484879..2484939 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AT694_RS12635 | 2480334..2480501 | - | 168 | WP_001790576.1 | hypothetical protein | - |
AT694_RS12645 | 2480732..2482465 | - | 1734 | WP_000486495.1 | ABC transporter ATP-binding protein/permease | - |
AT694_RS12650 | 2482490..2484253 | - | 1764 | WP_001064837.1 | ABC transporter ATP-binding protein/permease | - |
- | 2484879..2484939 | + | 61 | - | - | Antitoxin |
AT694_RS12660 | 2484956..2485063 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
AT694_RS12665 | 2485197..2485583 | - | 387 | WP_000779357.1 | flippase GtxA | - |
AT694_RS12670 | 2485851..2486993 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
AT694_RS12675 | 2487053..2487712 | + | 660 | WP_000831298.1 | membrane protein | - |
AT694_RS12680 | 2487894..2489105 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
AT694_RS12685 | 2489228..2489701 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T285633 WP_000482652.1 NZ_LN831036:c2485063-2484956 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT285633 NZ_LN831036:2484879-2484939 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|