Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2200302..2200519 | Replicon | chromosome |
| Accession | NZ_LN831036 | ||
| Organism | Staphylococcus aureus strain NCTC13435 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | AT694_RS11165 | Protein ID | WP_001802298.1 |
| Coordinates | 2200415..2200519 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF2 | ||
| Locus tag | - | ||
| Coordinates | 2200302..2200357 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AT694_RS11145 | 2196439..2197104 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| AT694_RS11150 | 2197256..2197576 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| AT694_RS11155 | 2197578..2198558 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| AT694_RS11160 | 2198824..2199915 | + | 1092 | WP_000495670.1 | lytic regulatory protein | - |
| - | 2200302..2200357 | + | 56 | - | - | Antitoxin |
| AT694_RS11165 | 2200415..2200519 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| AT694_RS14735 | 2201199..2201357 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| AT694_RS11170 | 2202015..2202872 | - | 858 | WP_000370929.1 | Cof-type HAD-IIB family hydrolase | - |
| AT694_RS11175 | 2202940..2203722 | - | 783 | WP_000908179.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T285631 WP_001802298.1 NZ_LN831036:c2200519-2200415 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT285631 NZ_LN831036:2200302-2200357 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|