Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2026362..2026661 | Replicon | chromosome |
Accession | NZ_LN831036 | ||
Organism | Staphylococcus aureus strain NCTC13435 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | AT694_RS14680 | Protein ID | WP_072353918.1 |
Coordinates | 2026485..2026661 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2026362..2026417 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AT694_RS10145 | 2021920..2022099 | + | 180 | WP_000669791.1 | hypothetical protein | - |
AT694_RS10155 | 2022410..2022670 | + | 261 | WP_001791826.1 | hypothetical protein | - |
AT694_RS10160 | 2022723..2023073 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
AT694_RS10165 | 2023584..2023919 | - | 336 | Protein_1913 | SH3 domain-containing protein | - |
AT694_RS10170 | 2024570..2025061 | - | 492 | WP_000920038.1 | staphylokinase | - |
AT694_RS10175 | 2025252..2026007 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
AT694_RS10180 | 2026019..2026273 | - | 255 | WP_000611512.1 | phage holin | - |
AT694_RS10185 | 2026325..2026432 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2026354..2026493 | + | 140 | NuclAT_0 | - | - |
- | 2026354..2026493 | + | 140 | NuclAT_0 | - | - |
- | 2026354..2026493 | + | 140 | NuclAT_0 | - | - |
- | 2026354..2026493 | + | 140 | NuclAT_0 | - | - |
- | 2026362..2026417 | + | 56 | - | - | Antitoxin |
AT694_RS14680 | 2026485..2026661 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
AT694_RS10190 | 2026804..2027178 | - | 375 | WP_000340977.1 | hypothetical protein | - |
AT694_RS10195 | 2027234..2027521 | - | 288 | WP_001262620.1 | hypothetical protein | - |
AT694_RS10200 | 2027567..2027719 | - | 153 | WP_001000058.1 | hypothetical protein | - |
AT694_RS10205 | 2027712..2031494 | - | 3783 | Protein_1922 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 2022723..2074416 | 51693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T285625 WP_072353918.1 NZ_LN831036:c2026661-2026485 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT285625 NZ_LN831036:2026362-2026417 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|