Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 674019..674688 | Replicon | chromosome |
| Accession | NZ_LN831035 | ||
| Organism | Haemophilus influenzae strain NCTC8143 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2R3G0F4 |
| Locus tag | AT683_RS03405 | Protein ID | WP_015701504.1 |
| Coordinates | 674019..674402 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A502K5Z3 |
| Locus tag | AT683_RS03410 | Protein ID | WP_005651224.1 |
| Coordinates | 674386..674688 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AT683_RS03370 | 670776..671099 | + | 324 | WP_015701510.1 | DUF2190 family protein | - |
| AT683_RS03375 | 671080..671391 | + | 312 | WP_015701509.1 | hypothetical protein | - |
| AT683_RS03380 | 671394..671924 | + | 531 | WP_015701508.1 | phage tail protein | - |
| AT683_RS03385 | 671933..672343 | + | 411 | WP_038440699.1 | phage tail protein | - |
| AT683_RS03390 | 672346..672996 | + | 651 | WP_050846007.1 | hypothetical protein | - |
| AT683_RS03395 | 673271..673678 | + | 408 | WP_038440705.1 | hypothetical protein | - |
| AT683_RS03400 | 673723..673950 | + | 228 | WP_058222178.1 | DUF4035 domain-containing protein | - |
| AT683_RS03405 | 674019..674402 | + | 384 | WP_015701504.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| AT683_RS03410 | 674386..674688 | + | 303 | WP_005651224.1 | XRE family transcriptional regulator | Antitoxin |
| AT683_RS03415 | 674704..674940 | + | 237 | WP_101494098.1 | hypothetical protein | - |
| AT683_RS03420 | 674992..678384 | + | 3393 | WP_058222179.1 | tape measure protein | - |
| AT683_RS03425 | 678393..678725 | + | 333 | WP_038440713.1 | phage tail protein | - |
| AT683_RS09670 | 678817..678975 | + | 159 | WP_005651234.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 642192..692498 | 50306 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14868.05 Da Isoelectric Point: 4.4987
>T285616 WP_015701504.1 NZ_LN831035:674019-674402 [Haemophilus influenzae]
MKQEWEVILQDPLLNWLETLAEDDVLKIYAALELLSTEGPQLSRPYADTLQGSKYTNLKELRVQSKLSVFRLFYIFDPVR
QAIVLCGGDKKGKKEKLFYKEMIALAEQTYDDYLSELTKEQENEREI
MKQEWEVILQDPLLNWLETLAEDDVLKIYAALELLSTEGPQLSRPYADTLQGSKYTNLKELRVQSKLSVFRLFYIFDPVR
QAIVLCGGDKKGKKEKLFYKEMIALAEQTYDDYLSELTKEQENEREI
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2R3G0F4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A502K5Z3 |