Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5280517..5281112 | Replicon | chromosome |
| Accession | NZ_LN831024 | ||
| Organism | Pseudomonas aeruginosa strain NCTC10332 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | AT700_RS29905 | Protein ID | WP_003113526.1 |
| Coordinates | 5280834..5281112 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | AT700_RS24300 | Protein ID | WP_003099268.1 |
| Coordinates | 5280517..5280822 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AT700_RS24265 | 5275658..5276506 | + | 849 | WP_003117426.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| AT700_RS24275 | 5276673..5277614 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| AT700_RS24280 | 5277731..5278345 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| AT700_RS24285 | 5278387..5278971 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| AT700_RS24290 | 5279012..5280112 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| AT700_RS24300 | 5280517..5280822 | - | 306 | WP_003099268.1 | HigA family addiction module antidote protein | Antitoxin |
| AT700_RS29905 | 5280834..5281112 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| AT700_RS24305 | 5281441..5283669 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| AT700_RS24310 | 5283739..5284386 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| AT700_RS24315 | 5284448..5285686 | - | 1239 | WP_009316205.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T285602 WP_003113526.1 NZ_LN831024:c5281112-5280834 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|