Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4622516..4623197 | Replicon | chromosome |
| Accession | NZ_LN831024 | ||
| Organism | Pseudomonas aeruginosa strain NCTC10332 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | AT700_RS21240 | Protein ID | WP_015503432.1 |
| Coordinates | 4622832..4623197 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A643IYQ7 |
| Locus tag | AT700_RS21235 | Protein ID | WP_034071998.1 |
| Coordinates | 4622516..4622839 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AT700_RS21210 | 4618429..4619067 | + | 639 | WP_003119439.1 | hypothetical protein | - |
| AT700_RS21215 | 4619310..4619645 | + | 336 | WP_003140884.1 | TM2 domain-containing protein | - |
| AT700_RS21220 | 4619819..4620337 | + | 519 | WP_012614469.1 | PAAR domain-containing protein | - |
| AT700_RS21225 | 4620334..4621035 | + | 702 | WP_048521411.1 | VRR-NUC domain-containing protein | - |
| AT700_RS21230 | 4621052..4622140 | + | 1089 | WP_048521414.1 | DUF3396 domain-containing protein | - |
| AT700_RS21235 | 4622516..4622839 | - | 324 | WP_034071998.1 | XRE family transcriptional regulator | Antitoxin |
| AT700_RS21240 | 4622832..4623197 | - | 366 | WP_015503432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| AT700_RS21245 | 4623461..4623700 | - | 240 | WP_048521765.1 | hypothetical protein | - |
| AT700_RS21250 | 4623907..4624179 | + | 273 | WP_003085667.1 | hypothetical protein | - |
| AT700_RS21255 | 4624198..4624623 | - | 426 | WP_017002478.1 | VOC family protein | - |
| AT700_RS21260 | 4624724..4625608 | + | 885 | WP_003085663.1 | LysR family transcriptional regulator | - |
| AT700_RS21265 | 4625581..4626534 | - | 954 | WP_003085661.1 | LysR family transcriptional regulator | - |
| AT700_RS21270 | 4626755..4627189 | + | 435 | WP_003116494.1 | RidA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13798.14 Da Isoelectric Point: 4.8219
>T285601 WP_015503432.1 NZ_LN831024:c4623197-4622832 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|