Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4247405..4247921 Replicon chromosome
Accession NZ_LN813019
Organism Halomonas sp. R57-5

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag HALO_RS19315 Protein ID WP_081899015.1
Coordinates 4247703..4247921 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name graA Uniprot ID A0A0D6EDK4
Locus tag HALO_RS19310 Protein ID WP_035576722.1
Coordinates 4247405..4247692 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HALO_RS19265 4242697..4242855 - 159 Protein_3804 alpha/beta hydrolase -
HALO_RS19270 4242939..4244135 + 1197 WP_035576728.1 homoserine O-acetyltransferase -
HALO_RS19275 4244280..4244579 - 300 WP_035576726.1 CcdB family protein -
HALO_RS19280 4244579..4244824 - 246 WP_035576725.1 type II toxin-antitoxin system CcdA family antitoxin -
HALO_RS19285 4245267..4245500 - 234 WP_081899016.1 hypothetical protein -
HALO_RS19290 4245479..4245781 - 303 WP_035564496.1 hypothetical protein -
HALO_RS19300 4246122..4246775 - 654 WP_035576724.1 DsbA family oxidoreductase -
HALO_RS19305 4246875..4247297 + 423 WP_050713883.1 hypothetical protein -
HALO_RS19310 4247405..4247692 - 288 WP_035576722.1 HigA family addiction module antidote protein Antitoxin
HALO_RS19315 4247703..4247921 - 219 WP_081899015.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
HALO_RS19320 4247950..4248831 - 882 WP_035576720.1 alpha/beta hydrolase -
HALO_RS19330 4249047..4249457 + 411 WP_035583067.1 hypothetical protein -
HALO_RS19335 4249499..4250461 - 963 WP_035576719.1 ribonuclease Z -
HALO_RS19340 4250613..4251086 - 474 WP_035576718.1 GNAT family N-acetyltransferase -
HALO_RS19345 4251732..4252259 - 528 WP_050713884.1 dual specificity protein phosphatase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(4-72)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(3-86)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8120.11 Da        Isoelectric Point: 5.5500

>T285572 WP_081899015.1 NZ_LN813019:c4247921-4247703 [Halomonas sp. R57-5]
VGEAAHAKRLRLILGQLNVASDANDMDLPGLRLHELPGKRSGIWSVTVSGNWRVTFRFEDVDAEIVNYEDYH

Download         Length: 219 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10486.18 Da        Isoelectric Point: 7.3596

>AT285572 WP_035576722.1 NZ_LN813019:c4247692-4247405 [Halomonas sp. R57-5]
MLMHNPPHLGEVLRELCLEPLGLTVTAAVEALGVSRKTLSAVLNGKAGISPEMAVRLSIAFDTSAESWLNQQSQYELWHA
EQHRKELKVKRLVAA

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0D6EDK4

References