Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 1318742..1319269 Replicon chromosome
Accession NZ_LN794217
Organism Rickettsia monacensis strain IrR/Munich

Toxin (Protein)


Gene name graT Uniprot ID A0A0B7J4T2
Locus tag RMONA_RS07025 Protein ID WP_023507944.1
Coordinates 1319063..1319269 (-) Length 69 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A0B7J6N2
Locus tag RMONA_RS07020 Protein ID WP_023507945.1
Coordinates 1318742..1319053 (-) Length 104 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RMONA_RS09470 1313830..1314120 - 291 WP_023507947.1 muropeptide transporter -
RMONA_RS09475 1314186..1314236 + 51 WP_157699855.1 palindromic element RPE4 domain-containing protein -
RMONA_RS06995 1314292..1315524 - 1233 WP_023507946.1 DEAD/DEAH box helicase -
RMONA_RS07000 1316034..1316246 - 213 WP_008579233.1 cold-shock protein -
RMONA_RS07005 1316870..1317133 + 264 WP_023507103.1 transposase -
RMONA_RS07010 1317175..1317435 + 261 WP_023507387.1 transposase -
RMONA_RS08930 1317892..1317981 + 90 WP_096001087.1 tetratricopeptide repeat protein -
RMONA_RS07020 1318742..1319053 - 312 WP_023507945.1 HigA family addiction module antidote protein Antitoxin
RMONA_RS07025 1319063..1319269 - 207 WP_023507944.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
RMONA_RS07030 1319251..1319511 - 261 WP_023507102.1 transposase -
RMONA_RS07035 1319553..1319816 - 264 WP_023507103.1 transposase -
RMONA_RS07040 1320444..1320842 + 399 Protein_1529 hypothetical protein -
RMONA_RS07045 1320857..1321627 - 771 WP_023507941.1 transposase -
RMONA_RS07050 1322275..1322517 + 243 WP_023507939.1 hypothetical protein -
RMONA_RS07055 1322525..1323436 - 912 WP_023507938.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(11-68)

Antitoxin

Cro/C1-type helix-turn-helix domain

(11-65)


Sequences

Toxin        


Download         Length: 69 a.a.        Molecular weight: 7805.85 Da        Isoelectric Point: 6.4646

>T285569 WP_023507944.1 NZ_LN794217:c1319269-1319063 [Rickettsia monacensis]
MYFLSIIGVILLNSAININDLCSPPGNNLKSLKGDRVDQHSIRINDQWRICFTWHDGNAHNVEIVDYH

Download         Length: 207 bp

Antitoxin


Download         Length: 104 a.a.        Molecular weight: 11974.74 Da        Isoelectric Point: 7.5249

>AT285569 WP_023507945.1 NZ_LN794217:c1319053-1318742 [Rickettsia monacensis]
MHQLLDLVTPGEVLEEEFMKPLNISQNRLARDIDVPPSRIHAIVHGRRSITADMALRLGKYFQTSAQMWINLQSHYDLEV
AERNEWSHIKHRIRTMEVASKAS

Download         Length: 312 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0B7J4T2

Antitoxin

Source ID Structure
AlphaFold DB A0A0B7J6N2

References