Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 149461..150119 | Replicon | plasmid II |
| Accession | NZ_LN681228 | ||
| Organism | Xenorhabdus nematophila AN6/1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | D3VM97 |
| Locus tag | XNC2_RS20430 | Protein ID | WP_013141682.1 |
| Coordinates | 149769..150119 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | XNC2_RS20425 | Protein ID | WP_038220207.1 |
| Coordinates | 149461..149763 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XNC2_RS20375 | 144746..145582 | + | 837 | WP_013141672.1 | DsbA family protein | - |
| XNC2_RS20380 | 145639..146067 | + | 429 | WP_013141673.1 | hypothetical protein | - |
| XNC2_RS20385 | 146124..146489 | + | 366 | WP_013141674.1 | hypothetical protein | - |
| XNC2_RS20390 | 146483..146929 | + | 447 | WP_013141675.1 | hypothetical protein | - |
| XNC2_RS20395 | 146926..147174 | + | 249 | Protein_164 | nitrite reductase | - |
| XNC2_RS20400 | 147170..147976 | + | 807 | Protein_165 | hypothetical protein | - |
| XNC2_RS20410 | 148193..148720 | + | 528 | WP_038220206.1 | thermonuclease family protein | - |
| XNC2_RS20415 | 148778..149050 | + | 273 | WP_013141679.1 | HU family DNA-binding protein | - |
| XNC2_RS20420 | 149139..149432 | + | 294 | WP_038220236.1 | chromosome segregation protein ParM | - |
| XNC2_RS20425 | 149461..149763 | - | 303 | WP_038220207.1 | XRE family transcriptional regulator | Antitoxin |
| XNC2_RS20430 | 149769..150119 | - | 351 | WP_013141682.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| XNC2_RS23600 | 150308..150559 | + | 252 | WP_041574001.1 | hypothetical protein | - |
| XNC2_RS20440 | 150559..150753 | + | 195 | WP_013141683.1 | hypothetical protein | - |
| XNC2_RS20445 | 150764..151135 | + | 372 | WP_038220209.1 | hypothetical protein | - |
| XNC2_RS20450 | 151128..151598 | + | 471 | WP_041574002.1 | hypothetical protein | - |
| XNC2_RS23170 | 151601..151798 | + | 198 | WP_041574003.1 | hypothetical protein | - |
| XNC2_RS20460 | 152019..152381 | + | 363 | WP_038220238.1 | hypothetical protein | - |
| XNC2_RS20465 | 152374..153624 | + | 1251 | WP_038220211.1 | site-specific DNA-methyltransferase | - |
| XNC2_RS20470 | 153621..153821 | + | 201 | WP_038220213.1 | hypothetical protein | - |
| XNC2_RS23175 | 153859..154044 | + | 186 | WP_041574004.1 | hypothetical protein | - |
| XNC2_RS20480 | 154196..154414 | + | 219 | WP_013141690.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..154559 | 154559 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13300.16 Da Isoelectric Point: 5.2421
>T285563 WP_013141682.1 NZ_LN681228:c150119-149769 [Xenorhabdus nematophila AN6/1]
MWAIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPLRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWAIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPLRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|