Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 149461..150119 Replicon plasmid II
Accession NZ_LN681228
Organism Xenorhabdus nematophila AN6/1

Toxin (Protein)


Gene name higB Uniprot ID D3VM97
Locus tag XNC2_RS20430 Protein ID WP_013141682.1
Coordinates 149769..150119 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag XNC2_RS20425 Protein ID WP_038220207.1
Coordinates 149461..149763 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
XNC2_RS20375 144746..145582 + 837 WP_013141672.1 DsbA family protein -
XNC2_RS20380 145639..146067 + 429 WP_013141673.1 hypothetical protein -
XNC2_RS20385 146124..146489 + 366 WP_013141674.1 hypothetical protein -
XNC2_RS20390 146483..146929 + 447 WP_013141675.1 hypothetical protein -
XNC2_RS20395 146926..147174 + 249 Protein_164 nitrite reductase -
XNC2_RS20400 147170..147976 + 807 Protein_165 hypothetical protein -
XNC2_RS20410 148193..148720 + 528 WP_038220206.1 thermonuclease family protein -
XNC2_RS20415 148778..149050 + 273 WP_013141679.1 HU family DNA-binding protein -
XNC2_RS20420 149139..149432 + 294 WP_038220236.1 chromosome segregation protein ParM -
XNC2_RS20425 149461..149763 - 303 WP_038220207.1 XRE family transcriptional regulator Antitoxin
XNC2_RS20430 149769..150119 - 351 WP_013141682.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
XNC2_RS23600 150308..150559 + 252 WP_041574001.1 hypothetical protein -
XNC2_RS20440 150559..150753 + 195 WP_013141683.1 hypothetical protein -
XNC2_RS20445 150764..151135 + 372 WP_038220209.1 hypothetical protein -
XNC2_RS20450 151128..151598 + 471 WP_041574002.1 hypothetical protein -
XNC2_RS23170 151601..151798 + 198 WP_041574003.1 hypothetical protein -
XNC2_RS20460 152019..152381 + 363 WP_038220238.1 hypothetical protein -
XNC2_RS20465 152374..153624 + 1251 WP_038220211.1 site-specific DNA-methyltransferase -
XNC2_RS20470 153621..153821 + 201 WP_038220213.1 hypothetical protein -
XNC2_RS23175 153859..154044 + 186 WP_041574004.1 hypothetical protein -
XNC2_RS20480 154196..154414 + 219 WP_013141690.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..154559 154559


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13300.16 Da        Isoelectric Point: 5.2421

>T285563 WP_013141682.1 NZ_LN681228:c150119-149769 [Xenorhabdus nematophila AN6/1]
MWAIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPLRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 10952.72 Da        Isoelectric Point: 9.5936

>AT285563 WP_038220207.1 NZ_LN681228:c149763-149461 [Xenorhabdus nematophila AN6/1]
MARTLDQMLATEKPDVVAKAQKAATEMLLNIHLAELRSRMKITQGEIAASLGVKQPTVSDMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFSV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A501XS03

Antitoxin

Source ID Structure

References