Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4406779..4407506 | Replicon | chromosome |
Accession | NZ_LN681227 | ||
Organism | Xenorhabdus nematophila AN6/1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | D3VFW9 |
Locus tag | XNC2_RS19450 | Protein ID | WP_013185754.1 |
Coordinates | 4407195..4407506 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | XNC2_RS19445 | Protein ID | WP_013185753.1 |
Coordinates | 4406779..4407198 (-) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XNC2_RS19425 | 4403012..4404502 | + | 1491 | WP_013185749.1 | inorganic phosphate transporter PitA | - |
XNC2_RS19430 | 4404628..4404957 | - | 330 | WP_010846191.1 | universal stress protein UspB | - |
XNC2_RS19435 | 4405346..4406470 | - | 1125 | Protein_3858 | IS701 family transposase | - |
XNC2_RS19440 | 4406512..4406679 | - | 168 | WP_013185752.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
XNC2_RS19445 | 4406779..4407198 | - | 420 | WP_013185753.1 | helix-turn-helix domain-containing protein | Antitoxin |
XNC2_RS19450 | 4407195..4407506 | - | 312 | WP_013185754.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
XNC2_RS19455 | 4408079..4410151 | - | 2073 | WP_013185755.1 | phenylacetic acid degradation bifunctional protein PaaZ | - |
XNC2_RS19460 | 4410480..4411421 | + | 942 | WP_010846184.1 | 1,2-phenylacetyl-CoA epoxidase subunit A | - |
XNC2_RS19465 | 4411492..4411779 | + | 288 | WP_013185756.1 | 1,2-phenylacetyl-CoA epoxidase subunit B | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12535.52 Da Isoelectric Point: 10.0558
>T285560 WP_013185754.1 NZ_LN681227:c4407506-4407195 [Xenorhabdus nematophila AN6/1]
MHVISKEPFEQAVRDYPNDANVLITTYKLLKEKNFDSPLELQKLFPSLDNFKHRNKWWVIDIGGNNLRMIAYINFMNKRF
YVKHIVTHKEYDKLTKKYRETKE
MHVISKEPFEQAVRDYPNDANVLITTYKLLKEKNFDSPLELQKLFPSLDNFKHRNKWWVIDIGGNNLRMIAYINFMNKRF
YVKHIVTHKEYDKLTKKYRETKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15251.61 Da Isoelectric Point: 5.6660
>AT285560 WP_013185753.1 NZ_LN681227:c4407198-4406779 [Xenorhabdus nematophila AN6/1]
MIREPIKALQATTALIAAVPFLGSSASEKDYRDALAMVDYLIENHDESPLINILAAKIAEYEDSNKRFAAFNKAVEVMPT
GVAALRVLMDQHGLSYSDLQEEIGSKSLISQIFSGKRALTIAHIKALSARFDVKPDIFL
MIREPIKALQATTALIAAVPFLGSSASEKDYRDALAMVDYLIENHDESPLINILAAKIAEYEDSNKRFAAFNKAVEVMPT
GVAALRVLMDQHGLSYSDLQEEIGSKSLISQIFSGKRALTIAHIKALSARFDVKPDIFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|