Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 2148151..2148902 | Replicon | chromosome |
| Accession | NZ_LN681227 | ||
| Organism | Xenorhabdus nematophila AN6/1 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | N1NQL5 |
| Locus tag | XNC2_RS09375 | Protein ID | WP_010845782.1 |
| Coordinates | 2148414..2148902 (+) | Length | 163 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | N1NPQ2 |
| Locus tag | XNC2_RS09370 | Protein ID | WP_010845781.1 |
| Coordinates | 2148151..2148423 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XNC2_RS09355 | 2144281..2144601 | - | 321 | Protein_1846 | IS110 family transposase | - |
| XNC2_RS22190 | 2144588..2144842 | + | 255 | Protein_1847 | transposase | - |
| XNC2_RS09360 | 2145315..2146076 | - | 762 | WP_013184313.1 | IS5 family transposase | - |
| XNC2_RS09365 | 2146249..2147643 | - | 1395 | WP_038218972.1 | basic amino acid/polyamine antiporter | - |
| XNC2_RS09370 | 2148151..2148423 | + | 273 | WP_010845781.1 | DUF1778 domain-containing protein | Antitoxin |
| XNC2_RS09375 | 2148414..2148902 | + | 489 | WP_010845782.1 | GNAT family N-acetyltransferase | Toxin |
| XNC2_RS09380 | 2149049..2150002 | - | 954 | WP_013184314.1 | DUF1471 domain-containing protein | - |
| XNC2_RS09385 | 2150968..2152500 | + | 1533 | WP_013184315.1 | Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha | - |
| XNC2_RS09390 | 2152511..2153899 | + | 1389 | WP_013184316.1 | Re/Si-specific NAD(P)(+) transhydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 2145315..2146076 | 761 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 163 a.a. Molecular weight: 18028.89 Da Isoelectric Point: 9.0545
>T285553 WP_010845782.1 NZ_LN681227:2148414-2148902 [Xenorhabdus nematophila AN6/1]
VGISTPEILTVKHNVKDFYCQHETLNEWLSRRALKNNKLGASRTFVICKEGTKDVIGYYCLSAGSINHIESTPSLKRNMP
DAIPVMLLGRLAVDAEYQGKKLGALLLQDAWKRVASTAEQVGISAIIVHAFDESARTFYMRLGFVQSPLESYTLMLPLGK
QN
VGISTPEILTVKHNVKDFYCQHETLNEWLSRRALKNNKLGASRTFVICKEGTKDVIGYYCLSAGSINHIESTPSLKRNMP
DAIPVMLLGRLAVDAEYQGKKLGALLLQDAWKRVASTAEQVGISAIIVHAFDESARTFYMRLGFVQSPLESYTLMLPLGK
QN
Download Length: 489 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|