Detailed information of TA system TA285551

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): Hha-TomB/-
• Location: 834578..835196
• Replicon: chromosome
• Accession: NZ_LN681227
• Organism: Xenorhabdus nematophila AN6/1

Toxin (Protein)

• Gene name: Hha
• Uniprot ID: N1NUC1
• Locus tag: XNC2_RS04050
• Protein ID: WP_010845060.1
• Coordinates: 834993..835196 (+)
• Length: 68 a.a.

Antitoxin (Protein)

• Gene name: TomB
• Uniprot ID: N1NQW2
• Locus tag: XNC2_RS04045
• Protein ID: WP_010845061.1
• Coordinates: 834578..834946 (+)
• Length: 123 a.a.

Genomic Context

Location: 829697..832846 (3150 bp)
Type: Others
Protein ID: WP_013183588.1

Location: 834578..834946 (369 bp)
Type: Antitoxin
Protein ID: WP_010845061.1

Location: 834993..835196 (204 bp)
Type: Toxin
Protein ID: WP_010845060.1

Location: 836024..836878 (855 bp)
Type: Others
Protein ID: WP_013183591.1

Location: 833025..834062 (1038 bp)
Type: Others
Protein ID: WP_013183589.1

Location: 837053..838336 (1284 bp)
Type: Others
Protein ID: WP_013183592.1

Location: 838351..838689 (339 bp)
Type: Others
Protein ID: WP_010845056.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
XNC2_RS04035	829697..832846	+	3150	WP_013183588.1	multidrug efflux RND transporter permease subunit	-
XNC2_RS04040	833025..834062	-	1038	WP_013183589.1	IS630 family transposase	-
XNC2_RS04045	834578..834946	+	369	WP_010845061.1	Hha toxicity modulator TomB	Antitoxin
XNC2_RS04050	834993..835196	+	204	WP_010845060.1	hemolysin expression modulator Hha	Toxin
XNC2_RS04055	836024..836878	+	855	WP_013183591.1	acyl-CoA thioesterase II	-
XNC2_RS04060	837053..838336	-	1284	WP_013183592.1	ammonium transporter AmtB	-
XNC2_RS04065	838351..838689	-	339	WP_010845056.1	P-II family nitrogen regulator	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_014228 Xenorhabdus nematophila ATCC 19061 Integrative and Conjugative Element TA024796 597788..1090259 0	inside	Integrative and Conjugative Element	-	acrB / lpxC	597760..1090208	492448

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Haemolysin expression modulating, HHA (8-64)

Antitoxin

• Biofilm formation regulator YbaJ (1-114)

Sequences

Toxin

Protein

• Length: 68 a.a.
• Molecular weight: 8077.34 Da
• Isoelectric Point: 6.9770

>T285551 WP_010845060.1 NZ_LN681227:834993-835196 [Xenorhabdus nematophila AN6/1]
MTKTDYLMRLRKCTSIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPSSVWKFVR

Nucleotide

• Length: 204 bp

Antitoxin

Protein

• Length: 123 a.a.
• Molecular weight: 14490.38 Da
• Isoelectric Point: 5.1920

>AT285551 WP_010845061.1 NZ_LN681227:834578-834946 [Xenorhabdus nematophila AN6/1]
MDEYSPKRYDIAELKYLCEKLIHEALSVLNRADSHWIHDLTSEKSLKLNELIEHIAAFVWNFKIKYTDHYDLSTLIDEYL
DETYNLFGSDKISFLELTKWQRTNEHLTNILLHDLNASLSKT

Nucleotide

• Length: 369 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: N1NUC1

Antitoxin

Loading, please wait

• AlphaFold DB: N1NQW2