Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 834578..835196 | Replicon | chromosome |
| Accession | NZ_LN681227 | ||
| Organism | Xenorhabdus nematophila AN6/1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | N1NUC1 |
| Locus tag | XNC2_RS04050 | Protein ID | WP_010845060.1 |
| Coordinates | 834993..835196 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | N1NQW2 |
| Locus tag | XNC2_RS04045 | Protein ID | WP_010845061.1 |
| Coordinates | 834578..834946 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XNC2_RS04035 | 829697..832846 | + | 3150 | WP_013183588.1 | multidrug efflux RND transporter permease subunit | - |
| XNC2_RS04040 | 833025..834062 | - | 1038 | WP_013183589.1 | IS630 family transposase | - |
| XNC2_RS04045 | 834578..834946 | + | 369 | WP_010845061.1 | Hha toxicity modulator TomB | Antitoxin |
| XNC2_RS04050 | 834993..835196 | + | 204 | WP_010845060.1 | hemolysin expression modulator Hha | Toxin |
| XNC2_RS04055 | 836024..836878 | + | 855 | WP_013183591.1 | acyl-CoA thioesterase II | - |
| XNC2_RS04060 | 837053..838336 | - | 1284 | WP_013183592.1 | ammonium transporter AmtB | - |
| XNC2_RS04065 | 838351..838689 | - | 339 | WP_010845056.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Integrative and Conjugative Element | - | acrB / lpxC | 597760..1090208 | 492448 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8077.34 Da Isoelectric Point: 6.9770
>T285551 WP_010845060.1 NZ_LN681227:834993-835196 [Xenorhabdus nematophila AN6/1]
MTKTDYLMRLRKCTSIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MTKTDYLMRLRKCTSIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14490.38 Da Isoelectric Point: 5.1920
>AT285551 WP_010845061.1 NZ_LN681227:834578-834946 [Xenorhabdus nematophila AN6/1]
MDEYSPKRYDIAELKYLCEKLIHEALSVLNRADSHWIHDLTSEKSLKLNELIEHIAAFVWNFKIKYTDHYDLSTLIDEYL
DETYNLFGSDKISFLELTKWQRTNEHLTNILLHDLNASLSKT
MDEYSPKRYDIAELKYLCEKLIHEALSVLNRADSHWIHDLTSEKSLKLNELIEHIAAFVWNFKIKYTDHYDLSTLIDEYL
DETYNLFGSDKISFLELTKWQRTNEHLTNILLHDLNASLSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|