Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 100846..101496 | Replicon | chromosome |
Accession | NZ_LN681227 | ||
Organism | Xenorhabdus nematophila AN6/1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | N1NNR7 |
Locus tag | XNC2_RS00455 | Protein ID | WP_010847562.1 |
Coordinates | 100846..101154 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | XNC2_RS00460 | Protein ID | WP_010847563.1 |
Coordinates | 101200..101496 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XNC2_RS22535 | 96630..96767 | + | 138 | WP_156148016.1 | hypothetical protein | - |
XNC2_RS00435 | 96745..96963 | + | 219 | Protein_83 | Fic family protein | - |
XNC2_RS00440 | 97099..98085 | - | 987 | WP_113967570.1 | sulfate ABC transporter substrate-binding protein | - |
XNC2_RS00445 | 98388..99365 | - | 978 | WP_013183083.1 | 6-phosphofructokinase | - |
XNC2_RS00450 | 99601..100500 | - | 900 | WP_010847560.1 | CDF family cation-efflux transporter FieF | - |
XNC2_RS00455 | 100846..101154 | + | 309 | WP_010847562.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
XNC2_RS00460 | 101200..101496 | + | 297 | WP_010847563.1 | helix-turn-helix domain-containing protein | Antitoxin |
XNC2_RS00470 | 101831..102247 | - | 417 | WP_010847564.1 | type II toxin-antitoxin system HicB family antitoxin | - |
XNC2_RS00475 | 102302..102476 | - | 175 | Protein_90 | type II toxin-antitoxin system HicA family toxin | - |
XNC2_RS00480 | 102608..103051 | - | 444 | WP_010847567.1 | hypothetical protein | - |
XNC2_RS00485 | 103424..103924 | - | 501 | WP_010847568.1 | Spy/CpxP family protein refolding chaperone | - |
XNC2_RS00490 | 104077..104769 | + | 693 | WP_013183086.1 | envelope stress response regulator transcription factor CpxR | - |
XNC2_RS00495 | 104766..106148 | + | 1383 | WP_013183087.1 | envelope stress sensor histidine kinase CpxA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11887.92 Da Isoelectric Point: 10.5016
>T285546 WP_010847562.1 NZ_LN681227:100846-101154 [Xenorhabdus nematophila AN6/1]
VYKRQVFSRERAELLTDDEFRHLQEHLLKNHEQGSTISATGGCKKIRLQREGMGKRGGVRIIYYTIIKTGMLYLLLIYPK
NKKDDLTPKQKEVLKAISNKLQ
VYKRQVFSRERAELLTDDEFRHLQEHLLKNHEQGSTISATGGCKKIRLQREGMGKRGGVRIIYYTIIKTGMLYLLLIYPK
NKKDDLTPKQKEVLKAISNKLQ
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|