Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrE-as-bsrE/- |
Location | 2087897..2088143 | Replicon | chromosome |
Accession | NZ_LN680001 | ||
Organism | Bacillus subtilis strain BS34A |
Toxin (Protein)
Gene name | bsrE | Uniprot ID | - |
Locus tag | VV28_RS22755 | Protein ID | WP_109789044.1 |
Coordinates | 2087897..2087989 (+) | Length | 31 a.a. |
Antitoxin (RNA)
Gene name | as-bsrE | ||
Locus tag | - | ||
Coordinates | 2087970..2088143 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VV28_RS10055 | 2083056..2083391 | + | 336 | WP_009967409.1 | hypothetical protein | - |
VV28_RS10060 | 2083438..2087043 | - | 3606 | WP_004399367.1 | membrane protein | - |
VV28_RS10065 | 2087276..2087608 | - | 333 | WP_026009814.1 | hypothetical protein | - |
VV28_RS22755 | 2087897..2087989 | + | 93 | WP_109789044.1 | type I toxin-antitoxin system toxin BsrE | Toxin |
- | 2087970..2088143 | - | 174 | - | - | Antitoxin |
VV28_RS10070 | 2088258..2089100 | - | 843 | WP_003231327.1 | hypothetical protein | - |
VV28_RS10075 | 2089300..2089758 | - | 459 | WP_003231326.1 | type II toxin-antitoxin system antitoxin YobK | - |
VV28_RS10080 | 2089768..2091570 | - | 1803 | WP_004399481.1 | type II toxin-antitoxin system toxin ribonuclease YobL | - |
VV28_RS10085 | 2091672..2092229 | - | 558 | WP_004399321.1 | SMI1/KNR4 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2073882..2097560 | 23678 | |
- | inside | Prophage | - | - | 2073882..2096640 | 22758 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 31 a.a. Molecular weight: 3358.16 Da Isoelectric Point: 4.1840
>T285523 WP_109789044.1 NZ_LN680001:2087897-2087989 [Bacillus subtilis]
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
Download Length: 93 bp
Antitoxin
Download Length: 174 bp
>AT285523 NZ_LN680001:c2088143-2087970 [Bacillus subtilis]
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|