Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrE-as-bsrE/- |
Location | 2087895..2088141 | Replicon | chromosome |
Accession | NZ_LN649259 | ||
Organism | Bacillus subtilis strain BS49 |
Toxin (Protein)
Gene name | bsrE | Uniprot ID | - |
Locus tag | VV34_RS23985 | Protein ID | WP_109789044.1 |
Coordinates | 2087895..2087987 (+) | Length | 31 a.a. |
Antitoxin (RNA)
Gene name | as-bsrE | ||
Locus tag | - | ||
Coordinates | 2087968..2088141 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VV34_RS10525 | 2083054..2083389 | + | 336 | WP_009967409.1 | hypothetical protein | - |
VV34_RS10530 | 2083436..2087041 | - | 3606 | WP_004399367.1 | membrane protein | - |
VV34_RS10535 | 2087274..2087606 | - | 333 | WP_026009814.1 | hypothetical protein | - |
VV34_RS23985 | 2087895..2087987 | + | 93 | WP_109789044.1 | type I toxin-antitoxin system toxin BsrE | Toxin |
- | 2087968..2088141 | - | 174 | - | - | Antitoxin |
VV34_RS10540 | 2088256..2089098 | - | 843 | WP_003231327.1 | hypothetical protein | - |
VV34_RS10545 | 2089298..2089756 | - | 459 | WP_003231326.1 | type II toxin-antitoxin system antitoxin YobK | - |
VV34_RS10550 | 2089766..2091568 | - | 1803 | WP_004399481.1 | type II toxin-antitoxin system toxin ribonuclease YobL | - |
VV34_RS10555 | 2091670..2092227 | - | 558 | WP_004399321.1 | SMI1/KNR4 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2073880..2097558 | 23678 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 31 a.a. Molecular weight: 3358.16 Da Isoelectric Point: 4.1840
>T285502 WP_109789044.1 NZ_LN649259:2087895-2087987 [Bacillus subtilis]
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
Download Length: 93 bp
Antitoxin
Download Length: 174 bp
>AT285502 NZ_LN649259:c2088141-2087968 [Bacillus subtilis]
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|