Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2560303..2560487 | Replicon | chromosome |
Accession | NZ_LN626917 | ||
Organism | Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SRS_RS13200 | Protein ID | WP_000482647.1 |
Coordinates | 2560380..2560487 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2560303..2560363 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SRS_RS13175 | 2555813..2555980 | - | 168 | Protein_2502 | hypothetical protein | - |
SRS_RS13185 | 2556211..2557944 | - | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein/permease | - |
SRS_RS13190 | 2557969..2559732 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein/permease | - |
- | 2560303..2560363 | + | 61 | - | - | Antitoxin |
SRS_RS13200 | 2560380..2560487 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SRS_RS13205 | 2560621..2561007 | - | 387 | WP_000779351.1 | flippase GtxA | - |
SRS_RS13210 | 2561275..2562417 | + | 1143 | WP_001176855.1 | glycerate kinase | - |
SRS_RS13215 | 2562477..2563136 | + | 660 | WP_000831298.1 | membrane protein | - |
SRS_RS13220 | 2563318..2564529 | + | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
SRS_RS13225 | 2564652..2565125 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T285498 WP_000482647.1 NZ_LN626917:c2560487-2560380 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT285498 NZ_LN626917:2560303-2560363 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|