Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 2535002..2535519 Replicon chromosome
Accession NZ_LN626917
Organism Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1

Toxin (Protein)


Gene name yoeB Uniprot ID A0A170NWK0
Locus tag SRS_RS13050 Protein ID WP_000251928.1
Coordinates 2535002..2535268 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A166LMC5
Locus tag SRS_RS13055 Protein ID WP_000584497.1
Coordinates 2535268..2535519 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SRS_RS13025 2530209..2530745 - 537 WP_000024292.1 GNAT family N-acetyltransferase -
SRS_RS13030 2531213..2532037 - 825 WP_000594640.1 formate/nitrite transporter family protein -
SRS_RS13035 2532240..2532422 - 183 WP_000079140.1 hypothetical protein -
SRS_RS13040 2532509..2532976 - 468 WP_000153340.1 SRPBCC domain-containing protein -
SRS_RS13045 2533162..2534709 - 1548 WP_045179540.1 zinc ABC transporter substrate-binding lipoprotein AdcA -
SRS_RS13050 2535002..2535268 - 267 WP_000251928.1 Txe/YoeB family addiction module toxin Toxin
SRS_RS13055 2535268..2535519 - 252 WP_000584497.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
SRS_RS13060 2535683..2535783 - 101 Protein_2480 hypothetical protein -
SRS_RS13065 2535790..2536389 - 600 WP_000162804.1 DsbA family protein -
SRS_RS13070 2536408..2536770 - 363 WP_000819843.1 DUF4467 domain-containing protein -
SRS_RS13075 2537025..2538275 + 1251 WP_001012237.1 FemA/FemB family glycyltransferase FmhA -
SRS_RS13080 2538372..2539103 - 732 WP_000615467.1 amino acid ABC transporter ATP-binding protein -
SRS_RS13085 2539100..2539819 - 720 WP_000479573.1 amino acid ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(8-88)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10465.06 Da        Isoelectric Point: 10.1628

>T285497 WP_000251928.1 NZ_LN626917:c2535268-2535002 [Staphylococcus aureus]
MVRLNITFSPQAFEDYKYFQQNDKKMVKKINELIKSIDRNGALKGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIK
IASCKYHY

Download         Length: 267 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9401.54 Da        Isoelectric Point: 4.3407

>AT285497 WP_000584497.1 NZ_LN626917:c2535519-2535268 [Staphylococcus aureus]
MIIKNYSYARQNLKALMTKVNDDSDIVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNNAEHLAQSIADLERGKTVTKD
IDV

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A170NWK0

Antitoxin

Source ID Structure
AlphaFold DB A0A166LMC5

References