Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1905438..1905618 | Replicon | chromosome |
Accession | NZ_LN626917 | ||
Organism | Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SRS_RS15600 | Protein ID | WP_001801861.1 |
Coordinates | 1905438..1905533 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1905561..1905618 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SRS_RS09530 | 1900582..1901208 | + | 627 | WP_000669038.1 | hypothetical protein | - |
SRS_RS09535 | 1901249..1901593 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
SRS_RS09540 | 1901691..1902263 | + | 573 | WP_000414222.1 | hypothetical protein | - |
SRS_RS09545 | 1902412..1903779 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
SRS_RS09550 | 1903779..1904348 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
SRS_RS09555 | 1904541..1904987 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
SRS_RS15600 | 1905438..1905533 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1905561..1905618 | - | 58 | - | - | Antitoxin |
SRS_RS09560 | 1905656..1905757 | + | 102 | WP_001791232.1 | hypothetical protein | - |
SRS_RS15210 | 1905932..1906374 | - | 443 | Protein_1862 | DUF1433 domain-containing protein | - |
SRS_RS09570 | 1906374..1906817 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
SRS_RS15215 | 1906817..1907259 | - | 443 | Protein_1864 | DUF1433 domain-containing protein | - |
SRS_RS09580 | 1907785..1910205 | + | 2421 | WP_045179297.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T285493 WP_001801861.1 NZ_LN626917:1905438-1905533 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT285493 NZ_LN626917:c1905618-1905561 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|