Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 376401..376663 | Replicon | chromosome |
Accession | NZ_LN626917 | ||
Organism | Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | SRS_RS01785 | Protein ID | WP_073392962.1 |
Coordinates | 376559..376663 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF | ||
Locus tag | - | ||
Coordinates | 376401..376564 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SRS_RS01765 | 371613..372371 | + | 759 | WP_000889176.1 | esterase family protein | - |
SRS_RS01770 | 372537..373262 | + | 726 | WP_001060544.1 | hypothetical protein | - |
SRS_RS01775 | 373264..374115 | + | 852 | WP_000355329.1 | hypothetical protein | - |
SRS_RS01780 | 374227..375873 | - | 1647 | WP_045178586.1 | IS1182-like element ISSau3 family transposase | - |
- | 376401..376564 | + | 164 | - | - | Antitoxin |
SRS_RS01785 | 376559..376663 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
SRS_RS14790 | 377343..377501 | + | 159 | WP_001792784.1 | hypothetical protein | - |
SRS_RS01790 | 378160..379017 | - | 858 | WP_000370937.1 | Cof-type HAD-IIB family hydrolase | - |
SRS_RS01795 | 379085..379867 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 374227..408163 | 33936 | |
- | flank | IS/Tn | - | - | 374227..375873 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T285485 WP_073392962.1 NZ_LN626917:c376663-376559 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 164 bp
>AT285485 NZ_LN626917:376401-376564 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCAAAGCGAATAGAAGGTT
ATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCAAAGCGAATAGAAGGTT
ATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|