Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 1703604..1704208 | Replicon | chromosome |
Accession | NZ_LN614827 | ||
Organism | Legionella fallonii LLAP-10 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A098G3A3 |
Locus tag | LFA_RS06905 | Protein ID | WP_045095532.1 |
Coordinates | 1703897..1704208 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LFA_RS06900 | Protein ID | WP_045095531.1 |
Coordinates | 1703604..1703894 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LFA_RS06880 | 1700695..1701318 | + | 624 | WP_045095527.1 | recombinase family protein | - |
LFA_RS06885 | 1701429..1702448 | + | 1020 | WP_045095528.1 | hypothetical protein | - |
LFA_RS06890 | 1702815..1703171 | - | 357 | WP_045095529.1 | hypothetical protein | - |
LFA_RS06895 | 1703172..1703567 | - | 396 | WP_045095530.1 | hypothetical protein | - |
LFA_RS06900 | 1703604..1703894 | - | 291 | WP_045095531.1 | helix-turn-helix domain-containing protein | Antitoxin |
LFA_RS06905 | 1703897..1704208 | - | 312 | WP_045095532.1 | hypothetical protein | Toxin |
LFA_RS06910 | 1704771..1705757 | + | 987 | WP_045095533.1 | FRG domain-containing protein | - |
LFA_RS06915 | 1705997..1706833 | - | 837 | WP_045095534.1 | hypothetical protein | - |
LFA_RS06920 | 1706949..1707920 | - | 972 | WP_197541205.1 | DUF3644 domain-containing protein | - |
LFA_RS06925 | 1708005..1708553 | - | 549 | WP_045095536.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11996.85 Da Isoelectric Point: 9.2614
>T285482 WP_045095532.1 NZ_LN614827:c1704208-1703897 [Legionella fallonii LLAP-10]
MIFIETPIFTEDVKELLLDEEYAEFQKYLADNPLAGDVIQQTGGLRKVRWSSQGKGKRGGVRVIYYYVTPASQIRLLLIY
KKGIQDDLSADQKKMLRQLNERW
MIFIETPIFTEDVKELLLDEEYAEFQKYLADNPLAGDVIQQTGGLRKVRWSSQGKGKRGGVRVIYYYVTPASQIRLLLIY
KKGIQDDLSADQKKMLRQLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|