Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3643282..3643504 | Replicon | chromosome |
| Accession | NZ_LM995446 | ||
| Organism | Escherichia coli strain K-12 substr. RV308 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | ECRV308_RS18065 | Protein ID | WP_000141634.1 |
| Coordinates | 3643282..3643389 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3643438..3643504 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECRV308_RS18040 | 3638535..3639287 | - | 753 | Protein_3435 | cellulose biosynthesis protein BcsQ | - |
| ECRV308_RS18045 | 3639299..3639487 | - | 189 | WP_001063318.1 | YhjR family protein | - |
| ECRV308_RS18050 | 3639760..3641331 | + | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
| ECRV308_RS18055 | 3641328..3641519 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| ECRV308_RS18060 | 3641516..3643195 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| ECRV308_RS18065 | 3643282..3643389 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| - | 3643438..3643504 | + | 67 | - | - | Antitoxin |
| ECRV308_RS18075 | 3643865..3645136 | + | 1272 | WP_001295225.1 | transporter | - |
| ECRV308_RS18080 | 3645166..3646170 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| ECRV308_RS18085 | 3646167..3647150 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| ECRV308_RS18090 | 3647161..3648063 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T285449 WP_000141634.1 NZ_LM995446:c3643389-3643282 [Escherichia coli]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT285449 NZ_LM995446:3643438-3643504 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|