Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 252005..252699 | Replicon | chromosome |
Accession | NZ_LM995446 | ||
Organism | Escherichia coli strain K-12 substr. RV308 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | ECRV308_RS01190 | Protein ID | WP_001263489.1 |
Coordinates | 252301..252699 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | ECRV308_RS01185 | Protein ID | WP_000554758.1 |
Coordinates | 252005..252298 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECRV308_RS01165 | 247637..248134 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
ECRV308_RS01170 | 248358..250070 | - | 1713 | Protein_224 | flagellar biosynthesis protein FlhA | - |
ECRV308_RS01175 | 250042..250827 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
ECRV308_RS01180 | 250898..251953 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
ECRV308_RS01185 | 252005..252298 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
ECRV308_RS01190 | 252301..252699 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
ECRV308_RS01195 | 252709..253161 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
ECRV308_RS01200 | 253479..253685 | + | 207 | Protein_230 | RtcB family protein | - |
ECRV308_RS01205 | 253681..254202 | + | 522 | Protein_231 | peptide chain release factor H | - |
ECRV308_RS01210 | 254259..255716 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
ECRV308_RS01215 | 255977..256435 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- | 257031..257111 | + | 81 | NuclAT_12 | - | - |
- | 257031..257111 | + | 81 | NuclAT_12 | - | - |
- | 257031..257111 | + | 81 | NuclAT_12 | - | - |
- | 257031..257111 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T285421 WP_001263489.1 NZ_LM995446:252301-252699 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |