Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4522707..4523119 | Replicon | chromosome |
Accession | NZ_LM993812 | ||
Organism | Escherichia coli strain K-12 substr. HMS174 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | ECHMS174_RS22330 | Protein ID | WP_000132601.1 |
Coordinates | 4522707..4523048 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4523043..4523119 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECHMS174_RS22320 | 4520120..4521166 | - | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
ECHMS174_RS22325 | 4521166..4522545 | - | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
ECHMS174_RS22330 | 4522707..4523048 | - | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
- | 4523043..4523119 | + | 77 | NuclAT_13 | - | Antitoxin |
- | 4523043..4523119 | + | 77 | NuclAT_13 | - | Antitoxin |
- | 4523043..4523119 | + | 77 | NuclAT_13 | - | Antitoxin |
- | 4523043..4523119 | + | 77 | NuclAT_13 | - | Antitoxin |
- | 4523043..4523119 | + | 77 | NuclAT_14 | - | Antitoxin |
- | 4523043..4523119 | + | 77 | NuclAT_14 | - | Antitoxin |
- | 4523043..4523119 | + | 77 | NuclAT_14 | - | Antitoxin |
- | 4523043..4523119 | + | 77 | NuclAT_14 | - | Antitoxin |
ECHMS174_RS22335 | 4523276..4524670 | - | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
ECHMS174_RS22340 | 4524667..4526256 | - | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4515622..4524670 | 9048 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T285416 WP_000132601.1 NZ_LM993812:c4523048-4522707 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT285416 NZ_LM993812:4523043-4523119 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|