Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1255420..1255642 Replicon chromosome
Accession NZ_LM993812
Organism Escherichia coli strain K-12 substr. HMS174

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag ECHMS174_RS06230 Protein ID WP_000170963.1
Coordinates 1255420..1255527 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1255575..1255642 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECHMS174_RS06200 1250729..1251811 + 1083 WP_000804726.1 peptide chain release factor 1 -
ECHMS174_RS06205 1251811..1252644 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
ECHMS174_RS06210 1252641..1253033 + 393 WP_000200374.1 invasion regulator SirB2 -
ECHMS174_RS06215 1253037..1253846 + 810 WP_001257044.1 invasion regulator SirB1 -
ECHMS174_RS06220 1253882..1254736 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
ECHMS174_RS06225 1254885..1254992 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1255040..1255106 + 67 NuclAT_33 - -
- 1255040..1255106 + 67 NuclAT_33 - -
- 1255040..1255106 + 67 NuclAT_33 - -
- 1255040..1255106 + 67 NuclAT_33 - -
- 1255040..1255106 + 67 NuclAT_35 - -
- 1255040..1255106 + 67 NuclAT_35 - -
- 1255040..1255106 + 67 NuclAT_35 - -
- 1255040..1255106 + 67 NuclAT_35 - -
- 1255040..1255106 + 67 NuclAT_37 - -
- 1255040..1255106 + 67 NuclAT_37 - -
- 1255040..1255106 + 67 NuclAT_37 - -
- 1255040..1255106 + 67 NuclAT_37 - -
- 1255040..1255106 + 67 NuclAT_39 - -
- 1255040..1255106 + 67 NuclAT_39 - -
- 1255040..1255106 + 67 NuclAT_39 - -
- 1255040..1255106 + 67 NuclAT_39 - -
- 1255040..1255106 + 67 NuclAT_41 - -
- 1255040..1255106 + 67 NuclAT_41 - -
- 1255040..1255106 + 67 NuclAT_41 - -
- 1255040..1255106 + 67 NuclAT_41 - -
- 1255040..1255106 + 67 NuclAT_43 - -
- 1255040..1255106 + 67 NuclAT_43 - -
- 1255040..1255106 + 67 NuclAT_43 - -
- 1255040..1255106 + 67 NuclAT_43 - -
- 1255042..1255107 + 66 NuclAT_17 - -
- 1255042..1255107 + 66 NuclAT_17 - -
- 1255042..1255107 + 66 NuclAT_17 - -
- 1255042..1255107 + 66 NuclAT_17 - -
- 1255042..1255107 + 66 NuclAT_20 - -
- 1255042..1255107 + 66 NuclAT_20 - -
- 1255042..1255107 + 66 NuclAT_20 - -
- 1255042..1255107 + 66 NuclAT_20 - -
- 1255042..1255107 + 66 NuclAT_23 - -
- 1255042..1255107 + 66 NuclAT_23 - -
- 1255042..1255107 + 66 NuclAT_23 - -
- 1255042..1255107 + 66 NuclAT_23 - -
- 1255042..1255107 + 66 NuclAT_26 - -
- 1255042..1255107 + 66 NuclAT_26 - -
- 1255042..1255107 + 66 NuclAT_26 - -
- 1255042..1255107 + 66 NuclAT_26 - -
- 1255042..1255107 + 66 NuclAT_29 - -
- 1255042..1255107 + 66 NuclAT_29 - -
- 1255042..1255107 + 66 NuclAT_29 - -
- 1255042..1255107 + 66 NuclAT_29 - -
- 1255042..1255107 + 66 NuclAT_32 - -
- 1255042..1255107 + 66 NuclAT_32 - -
- 1255042..1255107 + 66 NuclAT_32 - -
- 1255042..1255107 + 66 NuclAT_32 - -
ECHMS174_RS06230 1255420..1255527 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1255575..1255642 + 68 NuclAT_16 - Antitoxin
- 1255575..1255642 + 68 NuclAT_16 - Antitoxin
- 1255575..1255642 + 68 NuclAT_16 - Antitoxin
- 1255575..1255642 + 68 NuclAT_16 - Antitoxin
- 1255575..1255642 + 68 NuclAT_19 - Antitoxin
- 1255575..1255642 + 68 NuclAT_19 - Antitoxin
- 1255575..1255642 + 68 NuclAT_19 - Antitoxin
- 1255575..1255642 + 68 NuclAT_19 - Antitoxin
- 1255575..1255642 + 68 NuclAT_22 - Antitoxin
- 1255575..1255642 + 68 NuclAT_22 - Antitoxin
- 1255575..1255642 + 68 NuclAT_22 - Antitoxin
- 1255575..1255642 + 68 NuclAT_22 - Antitoxin
- 1255575..1255642 + 68 NuclAT_25 - Antitoxin
- 1255575..1255642 + 68 NuclAT_25 - Antitoxin
- 1255575..1255642 + 68 NuclAT_25 - Antitoxin
- 1255575..1255642 + 68 NuclAT_25 - Antitoxin
- 1255575..1255642 + 68 NuclAT_28 - Antitoxin
- 1255575..1255642 + 68 NuclAT_28 - Antitoxin
- 1255575..1255642 + 68 NuclAT_28 - Antitoxin
- 1255575..1255642 + 68 NuclAT_28 - Antitoxin
- 1255575..1255642 + 68 NuclAT_31 - Antitoxin
- 1255575..1255642 + 68 NuclAT_31 - Antitoxin
- 1255575..1255642 + 68 NuclAT_31 - Antitoxin
- 1255575..1255642 + 68 NuclAT_31 - Antitoxin
- 1255576..1255641 + 66 NuclAT_34 - -
- 1255576..1255641 + 66 NuclAT_34 - -
- 1255576..1255641 + 66 NuclAT_34 - -
- 1255576..1255641 + 66 NuclAT_34 - -
- 1255576..1255641 + 66 NuclAT_36 - -
- 1255576..1255641 + 66 NuclAT_36 - -
- 1255576..1255641 + 66 NuclAT_36 - -
- 1255576..1255641 + 66 NuclAT_36 - -
- 1255576..1255641 + 66 NuclAT_38 - -
- 1255576..1255641 + 66 NuclAT_38 - -
- 1255576..1255641 + 66 NuclAT_38 - -
- 1255576..1255641 + 66 NuclAT_38 - -
- 1255576..1255641 + 66 NuclAT_40 - -
- 1255576..1255641 + 66 NuclAT_40 - -
- 1255576..1255641 + 66 NuclAT_40 - -
- 1255576..1255641 + 66 NuclAT_40 - -
- 1255576..1255641 + 66 NuclAT_42 - -
- 1255576..1255641 + 66 NuclAT_42 - -
- 1255576..1255641 + 66 NuclAT_42 - -
- 1255576..1255641 + 66 NuclAT_42 - -
- 1255576..1255641 + 66 NuclAT_44 - -
- 1255576..1255641 + 66 NuclAT_44 - -
- 1255576..1255641 + 66 NuclAT_44 - -
- 1255576..1255641 + 66 NuclAT_44 - -
ECHMS174_RS06235 1255955..1256062 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1256110..1256177 + 68 NuclAT_15 - -
- 1256110..1256177 + 68 NuclAT_15 - -
- 1256110..1256177 + 68 NuclAT_15 - -
- 1256110..1256177 + 68 NuclAT_15 - -
- 1256110..1256177 + 68 NuclAT_18 - -
- 1256110..1256177 + 68 NuclAT_18 - -
- 1256110..1256177 + 68 NuclAT_18 - -
- 1256110..1256177 + 68 NuclAT_18 - -
- 1256110..1256177 + 68 NuclAT_21 - -
- 1256110..1256177 + 68 NuclAT_21 - -
- 1256110..1256177 + 68 NuclAT_21 - -
- 1256110..1256177 + 68 NuclAT_21 - -
- 1256110..1256177 + 68 NuclAT_24 - -
- 1256110..1256177 + 68 NuclAT_24 - -
- 1256110..1256177 + 68 NuclAT_24 - -
- 1256110..1256177 + 68 NuclAT_24 - -
- 1256110..1256177 + 68 NuclAT_27 - -
- 1256110..1256177 + 68 NuclAT_27 - -
- 1256110..1256177 + 68 NuclAT_27 - -
- 1256110..1256177 + 68 NuclAT_27 - -
- 1256110..1256177 + 68 NuclAT_30 - -
- 1256110..1256177 + 68 NuclAT_30 - -
- 1256110..1256177 + 68 NuclAT_30 - -
- 1256110..1256177 + 68 NuclAT_30 - -
ECHMS174_RS06240 1256466..1257566 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
ECHMS174_RS06245 1257836..1258066 + 231 WP_001146444.1 putative cation transport regulator ChaB -
ECHMS174_RS06250 1258224..1258919 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
ECHMS174_RS06255 1258963..1259316 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T285393 WP_000170963.1 NZ_LM993812:c1255527-1255420 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 68 bp

>AT285393 NZ_LM993812:1255575-1255642 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References