Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 1443547..1444202 | Replicon | chromosome |
| Accession | NZ_LK937696 | ||
| Organism | Coxiella burnetii Z3055 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | Q83BL3 |
| Locus tag | TY29_RS07605 | Protein ID | WP_010958264.1 |
| Coordinates | 1443864..1444202 (-) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | TY29_RS07600 | Protein ID | WP_010958263.1 |
| Coordinates | 1443547..1443858 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| TY29_RS07575 | 1438823..1439500 | - | 678 | WP_010958258.1 | cyclin | - |
| TY29_RS07585 | 1439819..1441201 | - | 1383 | WP_010958260.1 | cysteine--tRNA ligase | - |
| TY29_RS07590 | 1441192..1442589 | - | 1398 | WP_010958261.1 | glutamate--tRNA ligase | - |
| TY29_RS07595 | 1442746..1443478 | + | 733 | Protein_1449 | UDP-2,3-diacylglucosamine diphosphatase | - |
| TY29_RS07600 | 1443547..1443858 | - | 312 | WP_010958263.1 | HigA family addiction module antidote protein | Antitoxin |
| TY29_RS07605 | 1443864..1444202 | - | 339 | WP_010958264.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| TY29_RS07610 | 1444561..1445707 | + | 1147 | Protein_1452 | ISAs1 family transposase | - |
| TY29_RS07615 | 1446035..1447708 | + | 1674 | WP_012220680.1 | CBU_1493 family Dot/Icm T4SS effector | - |
| TY29_RS07620 | 1447874..1448605 | - | 732 | WP_041952479.1 | pyridoxine 5'-phosphate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1444616..1445707 | 1091 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13409.66 Da Isoelectric Point: 10.4588
>T285387 WP_010958264.1 NZ_LK937696:c1444202-1443864 [Coxiella burnetii Z3055]
MPLTLYIMLDVTRKTVILEVIIKSFKDKYTKYLYKGVSVSKWQAIRKQAERRLQILDSVTSLDDLRSLPSNRFESLRGNR
KGQFSIRINKQWRICFKWINNEPTEVEIVDYH
MPLTLYIMLDVTRKTVILEVIIKSFKDKYTKYLYKGVSVSKWQAIRKQAERRLQILDSVTSLDDLRSLPSNRFESLRGNR
KGQFSIRINKQWRICFKWINNEPTEVEIVDYH
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|