Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4734563..4735152 | Replicon | chromosome |
Accession | NZ_HG999364 | ||
Organism | Xanthomonas euroxanthea isolate Xanthomonas euroxanthea CPBF 766 isolated from C. illinoinensis |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A2S7AZR2 |
Locus tag | KHO05_RS20195 | Protein ID | WP_039429225.1 |
Coordinates | 4734871..4735152 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | KHO05_RS20190 | Protein ID | WP_184630970.1 |
Coordinates | 4734563..4734853 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KHO05_RS20160 (XCY_004024) | 4730040..4730654 | - | 615 | WP_212580452.1 | hypothetical protein | - |
KHO05_RS20165 (XCY_004025) | 4730754..4731395 | - | 642 | WP_212580453.1 | MAE_28990/MAE_18760 family HEPN-like nuclease | - |
KHO05_RS20170 (XCY_004026) | 4731392..4732318 | - | 927 | WP_244813306.1 | DUF262 domain-containing protein | - |
KHO05_RS20175 (XCY_004027) | 4732780..4733112 | + | 333 | Protein_3959 | hypothetical protein | - |
KHO05_RS20605 | 4733262..4733464 | + | 203 | Protein_3960 | hypothetical protein | - |
KHO05_RS20180 (XCY_004028) | 4733537..4733929 | - | 393 | WP_212580454.1 | hypothetical protein | - |
KHO05_RS20185 (XCY_004029) | 4733926..4734465 | - | 540 | WP_244813206.1 | hypothetical protein | - |
KHO05_RS20190 (XCY_004030) | 4734563..4734853 | - | 291 | WP_184630970.1 | HigA family addiction module antitoxin | Antitoxin |
KHO05_RS20195 (XCY_004031) | 4734871..4735152 | - | 282 | WP_039429225.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KHO05_RS20200 (XCY_004032) | 4735366..4735620 | + | 255 | WP_176340353.1 | antitoxin | - |
KHO05_RS20610 | 4735620..4735730 | + | 111 | Protein_3966 | type II toxin-antitoxin system RelE/ParE family toxin | - |
KHO05_RS20210 (XCY_004034) | 4735728..4736240 | - | 513 | WP_244813208.1 | hypothetical protein | - |
KHO05_RS20215 (XCY_004035) | 4736573..4738987 | - | 2415 | WP_212580456.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4721756..4736240 | 14484 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11046.72 Da Isoelectric Point: 9.7972
>T285352 WP_039429225.1 NZ_HG999364:c4735152-4734871 [Xanthomonas euroxanthea]
MIRSFVDKEAEKIWLGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
MIRSFVDKEAEKIWLGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|