Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4917470..4918072 | Replicon | chromosome |
Accession | NZ_HG994851 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | LLO82_RS23720 | Protein ID | WP_000897305.1 |
Coordinates | 4917761..4918072 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LLO82_RS23715 | Protein ID | WP_000356397.1 |
Coordinates | 4917470..4917760 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO82_RS23695 (4913972) | 4913972..4914874 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
LLO82_RS23700 (4914871) | 4914871..4915506 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
LLO82_RS23705 (4915503) | 4915503..4916432 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
LLO82_RS23710 (4916647) | 4916647..4916865 | - | 219 | WP_001298592.1 | CopG family transcriptional regulator | - |
LLO82_RS23715 (4917470) | 4917470..4917760 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
LLO82_RS23720 (4917761) | 4917761..4918072 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
LLO82_RS23725 (4918301) | 4918301..4919209 | + | 909 | WP_001298596.1 | alpha/beta hydrolase | - |
LLO82_RS23730 (4919273) | 4919273..4920214 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
LLO82_RS23735 (4920259) | 4920259..4920696 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
LLO82_RS23740 (4920693) | 4920693..4921565 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
LLO82_RS23745 (4921559) | 4921559..4922158 | - | 600 | WP_001298594.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12172.16 Da Isoelectric Point: 9.7791
>T285338 WP_000897305.1 NZ_HG994851:c4918072-4917761 [Escherichia coli]
ILFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
ILFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|