Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4308622..4309034 | Replicon | chromosome |
Accession | NZ_HG994851 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | symE | Uniprot ID | S1NWQ7 |
Locus tag | LLO82_RS20885 | Protein ID | WP_000132614.1 |
Coordinates | 4308693..4309034 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4308622..4308698 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO82_RS20875 (4305297) | 4305297..4306766 | + | 1470 | WP_001540814.1 | type I restriction-modification system subunit M | - |
LLO82_RS20880 (4306766) | 4306766..4308472 | + | 1707 | WP_001100194.1 | restriction endonuclease subunit S | - |
- (4308622) | 4308622..4308698 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4308622) | 4308622..4308698 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4308622) | 4308622..4308698 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4308622) | 4308622..4308698 | - | 77 | NuclAT_6 | - | Antitoxin |
- (4308622) | 4308622..4308698 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4308622) | 4308622..4308698 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4308622) | 4308622..4308698 | - | 77 | NuclAT_7 | - | Antitoxin |
- (4308622) | 4308622..4308698 | - | 77 | NuclAT_7 | - | Antitoxin |
LLO82_RS20885 (4308693) | 4308693..4309034 | + | 342 | WP_000132614.1 | endoribonuclease SymE | Toxin |
LLO82_RS20890 (4309081) | 4309081..4310244 | - | 1164 | WP_072002093.1 | DUF1524 domain-containing protein | - |
LLO82_RS20895 (4310292) | 4310292..4311174 | - | 883 | Protein_4094 | DUF262 domain-containing protein | - |
LLO82_RS20905 (4311364) | 4311364..4311441 | + | 78 | Protein_4095 | hypothetical protein | - |
LLO82_RS20910 (4311580) | 4311580..4312500 | - | 921 | WP_000181195.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
LLO82_RS20915 (4312685) | 4312685..4313965 | + | 1281 | WP_001298033.1 | DUF445 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | cheD | 4292501..4311237 | 18736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12266.07 Da Isoelectric Point: 8.4982
>T285332 WP_000132614.1 NZ_HG994851:4308693-4309034 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT285332 NZ_HG994851:c4308698-4308622 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|