Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4183398..4183656 | Replicon | chromosome |
Accession | NZ_HG994851 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | LLO82_RS20215 | Protein ID | WP_000809168.1 |
Coordinates | 4183504..4183656 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4183398..4183455 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO82_RS20200 | 4179227..4180486 | - | 1260 | WP_000494927.1 | hypothetical protein | - |
LLO82_RS20205 | 4180615..4182108 | - | 1494 | WP_001314416.1 | sulfatase-like hydrolase/transferase | - |
LLO82_RS20210 | 4182128..4182889 | - | 762 | WP_001274828.1 | outer membrane protein OmpK | - |
- | 4183398..4183455 | - | 58 | - | - | Antitoxin |
LLO82_RS20215 | 4183504..4183656 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
LLO82_RS20220 | 4183761..4184891 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
LLO82_RS20225 | 4184980..4186896 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
LLO82_RS20230 | 4187268..4187672 | + | 405 | WP_000843689.1 | DUF2541 family protein | - |
LLO82_RS20235 | 4187698..4188411 | + | 714 | WP_001102393.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T285331 WP_000809168.1 NZ_HG994851:4183504-4183656 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT285331 NZ_HG994851:c4183455-4183398 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|