Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3921726..3922420 | Replicon | chromosome |
Accession | NZ_HG994851 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | LLO82_RS18910 | Protein ID | WP_001263500.1 |
Coordinates | 3921726..3922124 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | LLO82_RS18915 | Protein ID | WP_000554758.1 |
Coordinates | 3922127..3922420 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO82_RS18885 (3917091) | 3917091..3917549 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
LLO82_RS18890 (3917810) | 3917810..3919267 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
LLO82_RS18895 (3919324) | 3919324..3919938 | - | 615 | WP_000602124.1 | peptide chain release factor H | - |
LLO82_RS18900 (3919935) | 3919935..3921074 | - | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
LLO82_RS18905 (3921264) | 3921264..3921716 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
LLO82_RS18910 (3921726) | 3921726..3922124 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
LLO82_RS18915 (3922127) | 3922127..3922420 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
LLO82_RS18920 (3922472) | 3922472..3923527 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
LLO82_RS18925 (3923598) | 3923598..3924383 | - | 786 | WP_000207578.1 | putative lateral flagellar export/assembly protein LafU | - |
LLO82_RS18930 (3924355) | 3924355..3926067 | + | 1713 | Protein_3710 | flagellar biosynthesis protein FlhA | - |
LLO82_RS18935 (3926387) | 3926387..3926884 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T285329 WP_001263500.1 NZ_HG994851:c3922124-3921726 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|