Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3619425..3620104 | Replicon | chromosome |
Accession | NZ_HG994851 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | LLO82_RS17500 | Protein ID | WP_000057523.1 |
Coordinates | 3619802..3620104 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | LLO82_RS17495 | Protein ID | WP_000806442.1 |
Coordinates | 3619425..3619766 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO82_RS17485 (3615669) | 3615669..3616601 | - | 933 | WP_000883025.1 | glutaminase A | - |
LLO82_RS17490 (3616863) | 3616863..3619367 | + | 2505 | WP_000083943.1 | copper-exporting P-type ATPase CopA | - |
LLO82_RS17495 (3619425) | 3619425..3619766 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
LLO82_RS17500 (3619802) | 3619802..3620104 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LLO82_RS17505 (3620237) | 3620237..3621031 | + | 795 | WP_000365148.1 | TraB/GumN family protein | - |
LLO82_RS17510 (3621235) | 3621235..3621714 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
LLO82_RS17515 (3621738) | 3621738..3622538 | + | 801 | WP_000439798.1 | hypothetical protein | - |
LLO82_RS17520 (3622535) | 3622535..3623038 | + | 504 | WP_000667000.1 | hypothetical protein | - |
LLO82_RS17525 (3623076) | 3623076..3624728 | - | 1653 | WP_000771760.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T285326 WP_000057523.1 NZ_HG994851:c3620104-3619802 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|